Chuyện lạ 2012-12-15 18:05:23

Mất Hơn... 3 Giờ Để Đọc Từ Dài Nhất Thế Giới


[size=6]Từ dài nhất này thực ra là tên một loại protein, gọi tắt là Titin, bắt đầu bằng “Methio” và kết thúc là “leucine”, tổng cộng có 189.819 ký tự.[/size]
Việc đọc hết chữ viết đầy đủ của protein Titin có thể khiến một người bình thường mờ cả mắt. Song một người đàn ông có tên là Dmitry Golubovskiy đã cố gắng đọc và dùng camera ghi lại toàn bộ quá trình từ lúc đọc đến khi kết thúc.

Anh Dmitry Golubovskiy đã mất hơn 3 tiếng để đọc xong tên loại proteinTổng thời gian tính được là 3 tiếng, 33 phút và 23 giây.
 
 
Thông thường, các loại protein thường được đặt bằng cách kết hợp tên của các chất hóa học tạo nên chúng.Vì Titin là loại protein lớn nhất được phát hiện từ trước tới nay, nên tên của nó cũng dài không khác gì kích thước của nó!
 
Tuy nhiên, tên đầy đủ của protein Titin không được liệt kê trong từ điển. Cho tới nay, từ dài nhất được nêu trong từ điển là một từ có 45 ký tự đó là "pneumonoultramicroscopicsilicovolcanoconiosis”.
Không thể thực hiện tác vụ do chủ đề hiện đang ở trạng thái lưu trữ

vãi cái từ 45 kí tự 3ahhyes3

tự đặt rồi bắt ng ta đọc là sao, rãnh trym lắm mà3burning3

 
CÁC THÍM CỨ TỪ TỪ MÀ ĐỌC NHÉ…
 
 

 
 

@shinnoshin1 v~ chưởng =)))

@shinnoshin1 david copy paste à lặp lại kìa 3ahh3

3blur33blur33blur3………………………………

#4465534 2
3blingeye3rất kiên nhẫn

đọc cái đó sẽ gây cảm giác ức chế cực kỳ, anh này kiên nhẫn thật 3ahhyes3

V CLDK MCDSHTYMCMB3bye3

KKANVNLWNGUOMCUOMMDMOOLCLVMWUAFQOUNMMCOSHFIASKFNKASDHIADVKNAIFHASNCIIWERKIASFHQOIOQKSNIAIFHASFASHFAAH
 
cho anh ấy 10 tiếng đọc và dịch được nghĩa của cụm từ trên 3crisp33crisp3

qẹo cm nó lưỡi =))

phát âm như nào để 1 hơi đọc hết từ đó nhễ , bác nào biết k 3ahhyes3

#4468059 0
hỉu đc mỗi từ crazy3ahhyes3 !!! còn nó đọc cái ì chắc thánh mới hỉu 3ahh3


 omowowowadawadawowewabbywabbow­ap omowowowadawadawowewabbywabbow­ap omowowowadawadawowewabbywobbow­ap omowowowadawadawowewabbywabbow­ap lalumuragawawobowewo omowowowabawanawowewabbawowowa­p lalumuragawawobowewo omowowowabawanawowewabbawowowa­p lalumuragawa lalumuragawawobowewo omowowowabawanawowewabbawowowa­p lalumuragawawobowewo  omowowowabawanawowewabbawowowa­p wabbywoobylalumuragawawobowewo
tuổi 
3crisp33crisp33crisp33crisp33crisp33crisp33crisp33crisp33crisp33crisp33crisp3                                       

Thằng nào hỉu đc và đọc đc là đứng ngang hàng với Steve Job =)) =)) =))3crisp33crisp3

vãi đạn =]]]]]]]]]]]]]]]]]]]
 

aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaâaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaâaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaâaa

45 ta nhìn còn không muốn đọc huống chi 189.8193crisp3

kxnvx,n nksmdcnixhz nmc.cmlkz,cm

kxnvx,n nksmdcnixhz nmc.cmlkz,cm

kimochi kimochi kimochi =)) 

lòi 2 con mắt á hì 

bố khĩ, tiếg VN kòn học chưa thôg hết cơ mà…


 
như thế này dài chưa nhỉ 3congratz3
 

#4467857 0
rap nhu tieng bulan anh vs bulan em ghe lun3ahhyes3

MariaOzawaMariaOzawaMariaOzawaMariaOzawa.MariaOzawa.MariaOzawa.MariaOzawa
MariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawa
MariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawa
MariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawa
MariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawaMariaOzawa





…………Đọc.Đi.Các.Thím……………….3ahh3

Tên full của protein đây:
Full chemical name of titin 

Methionylthreonylthreonylglutaminylala…
ylglutaminylprolylleucylglutaminylsery…
lserylthreonylalanylthreonylphenylalan…
rylglycylphenylalanylprolylvalylprolyl…
lanylarginylaspartylglycylglutaminylva…
nylleucylprolylglycylvalylglutaminylis…
ylglycylarginylalanyllysylleucylthreon…
llysylalanylasparaginylserylglycylargi…
eonylasparaginylglycylserylglycylgluta…
nylglutamylleucylleucylvalyllysylalany…
asparaginylphenylalanylvalylglutaminyl…
ylthreonylvalylarginylglutaminylglycyl…
utaminylvalylarginylvalylthreonylglycy…
lylvalyllysylphenylalanyltyrosylarginy…
cylglutaminylserylserylleucylaspartylp…
glutaminylglutamylglycylaspartylleucyl…
anylglutamylalanyltyrosylprolylglutamy…
serylvalylasparaginylalanylthreonylasp…
ylthreonylserylthreonylalanylglutamyll…
tamylglutamylglutamylvalylprolylalanyl…
eucylvalylserylthreonylalanylglutaminy…
glutaminylthreonylarginylisoleucylglut…
ylhistidylphenylalanylaspartylalanylar…
lylglutamylmethionylvalylisoleucylaspa…
nylglutaminylleucylprolylhistidyllysyl…
lprolylprolyllysylprolyllysylserylargi…
erylisoleucylalanylalanyllysylalanylgl…
ylglutaminylserylprolylserylprolylisol…
lprolylvalylarginylhistidylvalylarginy…
lylvalylarginylserylvalylserylprolylal…
onylserylprolylisoleucylarginylserylva…
thionylarginyllysylthreonylglutaminyla…
ylglycylprolylglutamylvalylprolylproly…
tamylglycyltyrosylvalylalanylserylsery…
ylarginylglutamylthreonylthreonylleucy…
minylisoleucylarginylthreonylglutamylg…
cylarginyltyrosylglycylvalylglutaminyl…
eucylserylglycylalanylalanylglycylalan…
serylalanylseryltyrosylalanylalanylglu…
lalanyllysylglutamylvalyllysylglutamin…
lanylalanylvalylalanylthreonylvalylval…
lalanylarginylvalylarginylglutamylprol…
tamylglutaminylthreonylalanylglutaminy…
eonylalanylvalylhistidylisoleucylgluta…
glutaminylvalylarginyllysylglutamylala…
threonyllysylvalylvalylvalylalanylalan…
lutaminylglutamylleucyllysylserylargin…
leucylthreonylthreonyllysylglutaminylg…
alylthreonylhistidylglutamylglutaminyl…
ylglutamyllysylthreonylphenylalanylval…
ylalanylalanyllysylalanyllysylglutamyl…
oleucylserylglutamylglutamylisoleucylt…
taminylvalylthreonylglutaminylglutamyl…
ylthreonylarginyllysylthreonylvalylval…
nylthreonylprolyllysylvalyllysylglutam…
larginylglycylarginylglutamylglycyliso…
lutamylglutaminylvalylglutaminylisoleu…
ethionylarginyllysylglutamylalanylglut…
hreonylisoleucylalanylvalylalanylthreo…
utaminylglutamylthreonylisoleucylleucy…
onylmethionylalanylthreonylarginylglut…
utaminylvalylthreonylhistidylglycyllys…
lalanylglutamylalanylvalylalanylthreon…
ylglutaminylalanylarginylvalylarginylg…
lycylhistidylleucylglutamylglutamylser…
threonylthreonylleucylglutamyltyrosylg…
leucylserylalanylalanyllysylvalylalany…
nylprolylalanylserylglutamylprolylhist…
llysylprolylarginylvalylisoleucylgluta…
nylhistidylisoleucyllysylthreonylthreo…
hionylhistidylisoleucylserylserylgluta…
eonylaspartylleucylthreonylthreonylglu…
laspartyllysylarginylprolylarginylthre…
alanylthreonylvalylseryllysylisoleucyl…
ylhistidylglycyltyrosylglutamylalanyls…
lisoleucylalanylthreonylleucylglutamin…
eonylserylserylalanylglutaminyllysylis…
alanylprolylthreonylvalyllysylprolylse…
nylalanylglutamylprolylthreonylprolyll…
olylphenylalanylalanylaspartylthreonyl…
erylglutamylalanylglycylvalylglutamylv…
lylserylisoleucylthreonylglycylthreony…
ylarginylphenylalanylglutamylvalylleuc…
yllysylvalylthreonylglutamylthreonylal…
alylglutamylisoleucylprolylvalylthreon…
rylglycylleucyllysylasparaginylvalylth…
lutamylserylvalylthreonylleucylglutamy…
cyltyrosylprolylserylprolylthreonylval…
lutamylaspartyltyrosylglutaminylisoleu…
tylphenylalanylglutaminylisoleucylthre…
ylisoleucylalanylarginylleucylmethiony…
ylalanylalanylglutamylaspartylserylgly…
inylserylalanylvalylasparaginylglutamy…
onylserylcysteinyltyrosylleucylalanylv…
tamylphenylalanylglutamyllysylglutamyl…
glutamyllysylphenylalanylthreonylthreo…
ylalanylvalylglutamylserylarginylaspar…
tylthreonylserylleucylthreonylglutamyl…
lglycylglutamylprolylalanylalanylproly…
yllysylprolylvalylvalylglutaminyllysyl…
lvalylvalylphenylalanylglycylcysteinyl…
nylprolyllysylprolylhistidylvalyltyros…
lylprolylleucylthreonylthreonylglycylt…
tyrosylasparaginyllysylglutaminylthreo…
ylvalylisoleucylserylmethionylthreonyl…
lanylglycylglutamyltyrosylthreonylisol…
sylhistidylglycylglutamylthreonylseryl…
lutamylglutamylalanylaspartyltyrosylgl…
ylglutaminylglutaminylglutamylmethiony…
taminylvalylthreonylalanylphenylalanyl…
ylvalylglycylglutamylthreonylalanylpro…
rylglutamyltyrosylglutamyllysylglutamy…
inylalanylleucylisoleucylarginyllysyll…
eonylvalylvalylvalylarginylthreonyltyr…
glutamylphenylalanylhistidylisoleucyls…
ylarginylleucylisoleucyllysylglutamyli…
ucylisoleucyllysylthreonylthreonylleuc…
mylglutamylaspartylglycylglutamylgluta…
lisoleucylserylglutamylserylglutamylal…
lanylaspartylleucylarginylisoleucyllys…
lleucylglutamylglycylmethionylglycylva…
einyllysylmethionylserylglycyltyrosylp…
yltryptophyltyrosyllysylaspartylglycyl…
lycylglutamylarginyltyrosylglutaminylm…
lutaminylaspartylglycylarginylalanylse…
lvalylleucylprolylglutamylaspartylglut…
lanylphenylalanylalanylserylasparaginy…
nylisoleucylcysteinylserylglycyllysyll…
ylalanylprolylleucylglycylalanylprolyl…
nylleucylglutamylprolylvalylserylargin…
rolylarginylserylvalylserylarginylsery…
ylprolylalanylarginylmethionylserylpro…
lalanylarginylmethionylserylprolylalan…
arginylarginylleucylglutamylglutamylth…
ylleucylglutamylarginylleucyltyrosylly…
yllysylprolylvalylserylphenylalanyllys…
ylasparaginylcysteinylarginylphenylala…
cylarginylprolylmethionylprolylglutamy…
ylalanylhistidylaspartylglycylglutamin…
ylaspartyltyrosylthreonylhistidyllysyl…
artylglycylthreonylglutaminylserylleuc…
ylthreonylprolylserylaspartylserylglyc…
lylalanylglutaminylasparaginylarginyla…
ylserylvalylisoleucylleucylthreonylval…
ylglutaminylvalyllysylprolylmethionylp…
lysylasparaginylvalylasparaginylisoleu…
eucylglutamylmethionyllysylvalylarginy…
lylasparaginylprolylaspartylisoleucylv…
lserylaspartylisoleucylisoleucylvalylp…
lisoleucylarginylisoleucylglutamylglyc…
alanylleucyllysylisoleucylaspartylsery…
ylserylalanyltryptophyltyrosylthreonyl…
ginyllysylalanylglycylarginylaspartylt…
lvalylasparaginylvalylglutamylvalylglu…
ylglutamylprolylglutamylarginyllysylle…
glycylthreonyltyrosylarginylalanyllysy…
lglutamylleucylglutamylprolylleucylhis…
aminylglutamylglutaminyltryptophylglut…
osylaspartyllysylglutamyllysylglutamin…
phenylalanyllysyllysyllysylleucylthreo…
inylphenylalanylglycylprolylalanylhist…
ginylleucylthreonylprolylisoleucylsery…
ylvalylglutamyltryptophylleucylhistidy…
tamylalanylalanylasparaginylarginylleu…
inylglutamylphenylalanylglycyltyrosylc…
lycylvalylalanyltyrosylserylarginylasp…
hreonylcysteinylarginylalanylthreonyla…
laspartylhistidylthreonylserylalanylth…
rtylglutamyllysylserylleucylvalylgluta…
lylglutamylglycylarginyllysylglycylleu…
ylglutamylleucylglutamylarginylmethion…
lleucylthreonylglycylvalylthreonylthre…
lysylglutaminyllysylprolylaspartylisol…
ylprolylvalylarginylvalylleucylglutamy…
lphenylalanylarginylcysteinylarginylva…
minylprolyllysylvalylasparaginyltrypto…
lutaminylleucylisoleucylarginyllysylse…
alylarginyltyrosylaspartylglycylisoleu…
leucylvalylaspartylcysteinyllysylseryl…
ylvalyllysylvalylthreonylalanylglutamy…
ylisoleucylglutamylhistidyllysylvalyll…
ylglutaminylarginylglutamylaspartylphe…
inylarginylalanylprolylglutamylprolyla…
tidylvalylhistidylglutamylprolylglycyl…
utamylvalylglutaminyllysylvalylasparty…
threonylglutamylthreonyllysylglutamylv…
nylglutamylarginylisoleucylthreonylhis…
ylglutamylserylglutamylglutamylleucyla…
ginylarginylthreonylglutamylglutamylgl…
leucylthreonylalanylvalylglutamylleucy…
lglutamylseryltyrosylglutamylglutamyll…
laspartylglutamylleucylleucylhistidylt…
lthreonylglutamylglutamylglutamyllysyl…
amylglycyllysylisoleucylthreonylisoleu…
rolylaspartyllysylisoleucylglutamylleu…
lalanylprolyllysylisoleucylphenylalany…
serylglutaminylthreonylvalylglycylglut…
idylphenylalanylarginylvalylarginylval…
lylglutamylcysteinylglutamyltryptophyl…
ysylisoleucylglutamylarginylserylaspar…
ltyrosyltryptophylprolylglutamylaspart…
leucylvalylisoleucylarginylaspartylval…
ylalanylserylisoleucylmethionylvalylly…
cylalanylglycylglutamylthreonylserylse…
leucylvalylglutaminylalanyllysylglutam…
anylthreonylglutaminylglutamylleucylgl…
ylglutamyllysylaspartylthreonylmethion…
lcysteinylglutamylthreonylserylglutamy…
ysyltryptophyltyrosyllysylaspartylglyc…
tamylglycylaspartyllysyltyrosylarginyl…
yllysylvalylhistidylphenylalanylleucyl…
ylaspartylthreonylserylaspartylalanylg…
lvalylleucylvalylglutamylaspartylgluta…
eonylalanyllysylleucylisoleucylvalylgl…
lphenylalanylvalyllysylglutamylleucylg…
alylprolylglutamylseryltyrosylserylgly…
soleucylvalylserylprolylglutamylaspara…
yptophyltyrosylhistidylasparaginylaspa…
paraginylglycyllysyltyrosylthreonyliso…
ycylarginylglutaminylasparaginylleucyl…
onyllysylglutamylaspartylglutaminylgly…
valylisoleucylaspartylglycyllysyllysyl…
llysylmethionyllysylprolylarginylproly…
aminylglycylleucylserylaspartylglutami…
laspartylisoleucylvalylglutaminylleucy…
glutamylserylvalylglutamylglycylvalylt…
ylglutaminylglutamylvalylglutaminylpro…
lisoleucylvalylisoleucylaspartyllysylg…
ylleucylisoleucylglutamylaspartylmethi…
anylglycylasparaginyltyrosylserylpheny…
lleucylglycylleucylserylthreonylserylg…
erylvalylaspartylvalylisoleucylthreony…
raginylvalylisoleucylglutamylglycylthr…
cysteinyllysylvalylserylvalylprolylasp…
yptophyltyrosylleucylasparaginylaspart…
rolylaspartylaspartylarginylvalylgluta…
lthreonyllysylglutaminylarginylleucylv…
onylhistidylalanylserylaspartylglutamy…
eucylvalylglycylarginylvalylglutamylth…
ylleucylserylvalylglutamyllysylisoleuc…
cylleucylarginylaspartylleucylthreonyl…
utaminylasparaginylvalylvalylphenylala…
histidylserylglycylisoleucylaspartylva…
lalanyllysylaspartyllysylglutamylisole…
yllysylisoleucylglutamylalanylhistidyl…
cylthreonylvalylleucylasparaginylmethi…
lutamylglycyllysyltyrosylthreonylpheny…
sparaginylmethionylthreonylserylglycyl…
lglycylalanylisoleucylseryllysylprolyl…
eonylvalylalanylglutamylserylglutaminy…
tamylcysteinylglutamylvalylalanylaspar…
lglutamyltryptophylleucylarginylaspart…
ucylthreonylasparaginylasparaginylisol…
tylglycylhistidyllysylarginylarginylle…
hreonyllysylleucylaspartylaspartylisol…
yrosyllysylvalylalanylthreonylseryllys…
ylvalylglutamylalanylvalyllysylisoleuc…
raginylleucylthreonylvalylthreonylglut…
lvalylphenylalanylthreonylvalylglutamy…
ginylvalyllysylglycylvalylglutaminyltr…
ycylvalylvalylleucylglutamylserylaspar…
leucylserylvalyllysylglycylthreonyliso…
eucyllysylasparaginylcysteinylalanylis…
lyltyrosylglycylphenylalanylarginylleu…
erylalanylarginylleucylhistidylvalylgl…
oleucyllysyllysylprolyllysylaspartylva…
raginylalanylthreonylvalylalanylphenyl…
istidylaspartylthreonylvalylprolylvaly…
llysylserylvalylglutamylisoleucyllysyl…
inylleucylvalylserylglutamylarginyllys…
leucylglutaminylasparaginylisoleucylse…
lutamyltyrosylthreonylalanylvalylvalyl…
inyllysylalanyllysylleucylphenylalanyl…
isoleucylthreonyllysylthreonylmethiony…
alylprolylglutamylthreonyllysylthreony…
teinylglutamylvalylserylhistidylphenyl…
thionyltryptophylleucyllysylasparaginy…
ylmethionylserylglutamyllysylphenylala…
ylglycyllysylleucylhistidylglutaminyll…
araginylthreonylserylthreonylglutamyla…
reonylphenylalanylvalylcysteinylglycyl…
erylalanylthreonylleucylthreonylvalylt…
eucylthreonylserylmethionylleucyllysyl…
lutamylglutamyllysylaspartylthreonylis…
valylthreonylvalylasparaginyltyrosylgl…
syltryptophylleucyllysylasparaginylgly…
threonylaspartyllysylcysteinylglutamin…
lleucylthreonylhistidylserylleucylaspa…
alylhistidylphenylalanylglycylaspartyl…
phenylalanylvalylalanylglycyllysylalan…
ylleucyltyrosylvalylglutamylalanylargi…
lanylarginyllysylhistidylisoleucyllysy…
lutamyllysyllysylarginylalanylmethiony…
mylvalylserylglutamylprolylaspartyliso…
phylmethionyllysylaspartylaspartylglut…
ucylthreonylaspartylarginylisoleucylly…
lysyltyrosylvalylhistidylarginylleucyl…
rginylmethionylserylaspartylalanylglyc…
nylglycylglycylasparaginylvalylserylth…
valylglutamylglycylarginylaspartylvaly…
cyllysyllysylglutamylvalylglutaminylva…
arginylalanylvalylvalylglutamylphenyla…
ylaspartylaspartylvalylaspartylalanylh…
ylglycylisoleucylglutamylisoleucylaspa…
lutaminylglutamylarginylhistidyllysylt…
nylisoleucylhistidylarginylmethionylph…
eonylarginylglutaminylserylaspartylala…
nylalanylvalylalanylglycylarginylaspar…
lleucyltyrosylvalylasparaginylalanylpr…
alylleucylglutaminylglutamylleucylglut…
minylserylglycyllysylprolylalanylargin…
nylisoleucylserylglycylarginylprolylgl…
yptophyltyrosyllysylglutamylglutamylgl…
ycylphenylalanyllysylcysteinyllysylphe…
ylglutaminylglutamyltyrosylthreonylleu…
nylphenylalanylprolylglutamylaspartyla…
einylglutamylalanyllysylasparaginylasp…
ylthreonylserylalanylserylleucylserylv…
lvalylserylprolylaspartylglutaminylglu…
lylprolylalanylisoleucylisoleucylthreo…
reonylvalylthreonylserylglutamylglycyl…
alanylglutaminylcysteinylarginylvalyls…
ylvalylseryltryptophyltyrosylseryllysy…
olylserylarginylphenylalanylphenylalan…
lphenylalanylglutamylaspartylthreonylt…
ucylalanylglutamylalanyltyrosylprolylg…
yltyrosylthreonylphenylalanylvalylalan…
glycylglutaminylvalylserylserylthreony…
glutamylalanylprolylglutamylserylisole…
oleucylglutamylglutaminylglutamylisole…
nyllysylglutamylphenylalanylserylseryl…
lutamylglutamylglutamylglycylleucylhis…
minylleucylseryllysylisoleucylasparagi…
ucylleucylserylglutamylserylprolylvaly…
anylaspartylserylglutamyllysylglutamyl…
phenylalanylisoleucyllysylglutamylvaly…
eucylserylmethionylglycylaspartylvalyl…
nylvalylisoleucylglycylisoleucylprolyl…
tryptophylphenylalanylphenylalanylaspa…
nylprolylserylalanylaspartyltyrosyllys…
rtylglycylaspartylaspartylhistidylsery…
ylalanylthreonyllysylleucylglutamylasp…
hreonylcysteinylmethionylalanylserylas…
threonylisoleucylcysteinylserylalanylt…
ylseryllysylglycylglutamylglycylhistid…
onylglutamylserylalanylvalylalanyllysy…
ylglycylprolylcysteinylprolylprolylhis…
lleucyllysylprolylisoleucylarginylcyst…
olylalanylisoleucylphenylalanylglutamy…
tamylprolylalanylprolylthreonylvalylth…
utamylasparaginyllysylglutaminylleucyl…
yrosylthreonylisoleucylisoleucylhistid…
lserylglycylthreonylphenylalanylisoleu…
utaminylarginylglutamylaspartylserylgl…
lysylalanylglutamylasparaginylmethiony…
ysteinylalanylalanylglutamylleucylleuc…
threonylaspartylmethionylthreonylaspar…
yllysylserylthreonylprolylglutamylalan…
lprolylglutaminylthreonylprolylleucyll…
alanylleucylaspartylserylglutamylgluta…
lphenylalanylvalyllysylaspartylthreony…
ucylisoleucylthreonylglutamylglutamyla…
lseryltyrosylglutamylhistidylisoleucyl…
lleucylserylserylglutaminylleucylproly…
ylleucylglutaminylserylisoleucylleucyl…
ylthreonylprolylglutamylserylthreonyla…
teinylisoleucylasparaginylglycylseryli…
nylprolylleucyllysylglutamylprolylsery…
eucylglutaminylisoleucylvalylglutaminy…
alanylseryllysylglutamylglycylisoleucy…
mylprolylglutamylthreonylglutaminylala…
glutamyllysylisoleucylphenylalanylprol…
lglutamylglutaminylisoleucylasparaginy…
olylleucyllysylthreonylleucylleucylala…
raginyltyrosylprolylglutaminylserylser…
ionylhistidylseryltyrosylleucylthreony…
lylleucylserylleucyllysylglutamyllysyl…
sparaginylarginylglutamylglutaminylarg…
sylglutaminylglutamylalanylglutaminyls…
lglutaminylserylleucylalanylglutamylgl…
lglutaminylserylprolylaspartylvalylmet…
asparaginyltyrosylglutamylprolylleucyl…
ylcysteinylthreonylglutamylglycylglycy…
mylserylalanylasparaginylprolylleucylg…
minylaspartylserylalanylvalylarginylis…
erylleucylarginylphenylalanylprolylleu…
lglutaminylvalylleucylleucyllysylgluta…
araginylvalylvalylmethionylprolylproly…
ylglutamylseryllysylarginylglutamylpro…
lylglutaminylglutamylvalylglutaminylgl…
llysylglutamylserylleucylleucylserylgl…
glutaminylarginylleucylasparaginylleuc…
cysteinylarginylalanylleucylglutaminyl…
lglutaminylprolylglycylleucylphenylala…
inylasparaginylisoleucylglutamyllysylv…
lasparaginylisoleucylthreonylglutaminy…
ucylmethionylcysteinylmethionyltyrosyl…
serylvalylthreonylglutamylglutamylvaly…
lglutamylaspartylvalylaspartylprolylgl…
eucyllysylmethionylglutamylleucylargin…
ylisoleucylisoleucyltyrosylglutamylglu…
ylthreonylalanylglutamylglycylprolylar…
lycylalanyllysylthreonylserylleucylglu…
artylserylphenylalanylserylglycylseryl…
soleucylthreonylglutamylprolylglutamyl…
lisoleucylserylthreonylglutamylglutamy…
aginylvalylglutaminylserylarginylvalyl…
eonylprolylvalylthreonyllysylglycylval…
spartylglutamyllysylglutaminylaspartyl…
glutamylglutamyllysylglutamylglutamyls…
reonylglutamylglutamylvalylalanylthreo…
tamylalanylglutamylglycylglycylleucyli…
prolylmethionylisoleucylhistidylthreon…
valylserylglutamylglutamylglycylaspart…
nylthreonylserylisoleucylthreonylaspar…
aginyltryptophyltyrosylphenylalanylglu…
lylserylaspartylglutamyllysylphenylala…
partylglutaminylasparaginylthreonyltyr…
artyllysylvalylasparaginylthreonylglut…
lglutamyltyrosylvalylcysteinylglutamyl…
lglycyllysylthreonylalanylthreonylsery…
llysylarginylalanylalanylprolylvalylis…
utamylprolylleucylglutamylvalylalanyll…
lphenylalanylthreonylcysteinylglutamyl…
lasparaginylvalylarginylphenylalanylgl…
alanylglycylarginylglutamylisoleucylty…
einylserylisoleucylarginylserylserylly…
glutamylisoleucylleucylarginylthreonyl…
ylglycylglutamyltyrosylthreonylcystein…
yltyrosylglycylserylvalylserylcysteiny…
ylvalylthreonylvalylprolylglycylglycyl…
leucylleucylprolylglutamylarginyllysyl…
utamylvalylvalylleucyllysylserylvalyll…
mylglutamylglutamylglutamylprolyllysyl…
glutamyllysylvalyllysyllysylprolylalan…
olylprolyllysylprolylvalylglutamylglut…
lvalylthreonyllysylarginylglutamylargi…
ylthreonyllysylvalylprolylglutamylisol…
ylleucylprolylalanylprolylglutamylprol…
nylglutamylvalyllysylthreonylisoleucyl…
lprolylglutamylprolylthreonylprolyliso…
ylvalylprolylvalylvalylglycyllysyllysy…
lyllysylglutamylglutamylalanylalanylly…
lysylglycylvalylprolyllysyllysylthreon…
lalanylglutamylarginylarginyllysylleuc…
cylglutamyllysylprolylprolylaspartylgl…
nyltyrosylglutaminylleucyllysylalanylv…
lyllysylglutamylisoleucyllysylaspartyl…
tamylserylglutamylphenylalanylvalylgly…
lanylglutamylcysteinylleucylvalylseryl…
hreonylthreonyltryptophylmethionyllysy…
eucylarginylglutamylserylprolyllysylhi…
lanylaspartylglycyllysylaspartylarginy…
cylaspartylvalylglutaminylleucylseryla…
hreonylcysteinylvalylleucylarginylleuc…
ylthreonylserylthreonylalanyllysylleuc…
rolylvalylarginylphenylalanylvalyllysy…
amylvalylthreonylvalylvalyllysylglycyl…
serylcysteinylglutamylleucylasparaginy…
alyltryptophylarginyllysylaspartylglyc…
ysylprolylglycylarginylisoleucylvalylp…
ylmethionylarginylalanylleucylthreonyl…
spartylaspartylthreonylaspartylalanylg…
reonylvalylglutamylasparaginylalanylas…
ysteinylserylserylcysteinylvalyllysylv…
nylaspartyltryptophylleucylvalyllysylp…
inylhistidylvalyllysylprolyllysylglycy…
lalanylcysteinylaspartylisoleucylalany…
inylisoleucyllysyltryptophylphenylalan…
lisoleucylprolylalanylglutamylprolylas…
mylisoleucylleucylarginylaspartylglycy…
ucyllysylisoleucyllysylasparaginylalan…
oleucylalanylglutamyltyrosylalanylvaly…
ylarginyltyrosylprolylalanyllysylleucy…
lglutamylvalylglutamylleucylleucyllysy…
ylthreonylisoleucyltyrosylglutamyllysy…
ylaspartylalanylglutamylisoleucylseryl…
ylglycylglutaminyltryptophyllysylleucy…
inylprolylserylprolylthreonylcysteinyl…
lglycylglycyllysylarginylphenylalanyll…
yllysylleucylaspartylglutaminylalanylg…
aminylalanylleucylasparaginylalanyliso…
ylleucylthreonylvalyllysylglutamylisol…
anylalanylvalylprolylleucyllysylaspart…
rginylarginylglutaminylalanylarginylph…
cylthreonylarginylglutamylalanylaspara…
ysylglycylprolylaspartylisoleucylisole…
nylalanylaspartylisoleucylisoleucylala…
isoleucylleucylvalylisoleucylasparagin…
ylaspartylaspartylglutamylglycylvalylt…
utamylglycyllysyllysylthreonylserylala…
reonylglycylisoleucylarginylleucyllysy…
ucylglutamylaspartylglutaminylthreonyl…
eonylalanylthreonylphenylalanylvalylcy…
lutamyllysylmethionylhistidylvalylvaly…
inylaspartylalanyllysylleucylhistidylt…
cylisoleucylserylserylglutamylglycylly…
mylmethionyllysylglutamylvalylthreonyl…
lglutaminylisoleucyllysylalanylglutami…
ylthreonylalanylglutaminylleucyllysylv…
lyltyrosylphenylalanylthreonylvalyllys…
ylalanylvalylglutamyllysylaspartylglut…
teinylglutamylvalylseryllysylaspartylv…
lalanyllysylaspartylglycylglutamylglut…
lysyltyrosylserylisoleucyllysylalanyla…
oleucylleucyllysylisoleucyllysyllysyla…
ylglycylglutamyltyrosylvalylcysteinyla…
tyllysylthreonyllysylalanylasparaginyl…
inylleucylisoleucylglutamylvalylglutam…
ylglutamylvalylphenylalanylvalylglycyl…
lalanylglutamylisoleucylglutamylleucyl…
tidylglycylglutaminyltryptophyllysylle…
ylthreonylalanylserylprolylaspartylcys…
tamylaspartylglycyllysyllysylhistidyli…
ylasparaginylcysteinylglutaminylleucyl…
ylvalylserylphenylalanylglutaminylalan…
alanylalanylasparaginylleucyllysylvaly…
leucylphenylalanylisoleucylthreonylpro…
ylphenylalanylglutamyllysylaspartylglu…
lcysteinylglutamylvalylserylarginylglu…
larginyltryptophylleucyllysylglycylthr…
eonylglycylaspartylaspartylarginylphen…
laspartylglycylthreonyllysylhistidylse…
lalanylalanylphenylalanylglutamylaspar…
nylphenylalanylglutamylalanylglutamyla…
ycyllysylleucylisoleucylisoleucylgluta…
lphenylalanylleucylthreonylprolylleucy…
sylglutamyllysylglutamylserylalanylval…
leucylserylhistidylaspartylasparaginyl…
lphenylalanyllysylasparaginylaspartylg…
nylthreonylarginylserylvalylserylmethi…
llysylthreonylhistidylserylisoleucylth…
ylserylisoleucylaspartylaspartylthreon…
lylglutamylalanylmethionylglycylmethio…
cylthreonylvalylleucylglutamylglycylas…
onylglycyllysylleucylglutaminylasparty…
lysylaspartylglutamylvalylisoleucylleu…
ucylseryllysylalanylaspartylalanylprol…
ysylaspartylglycyllysylglutamylisoleuc…
lanylvalylisoleucyllysylthreonylaspart…
eucylisoleucylleucyllysyllysylalanylle…
ylglutaminyltyrosylthreonylcysteinylas…
yllysylthreonylserylglycyllysylleucyla…
inylglutamylisoleucyllysylleucylvalyla…
lglutamylvalylmethionylglutamylthreony…
lalanylglutamylthreonylglutamylisoleuc…
eucylhistidylalanylasparaginyltryptoph…
nylleucylleucylglutaminylthreonylproly…
lysylglutamylglutamylglycyllysylisoleu…
stidylasparaginylcysteinylarginylleucy…
ycylvalylaspartylphenylalanylglutaminy…
erylserylalanylhistidylleucylarginylva…
glycylleucylleucylarginylprolylleucyll…
nylalanylglycylglutamylthreonylalanylt…
lglutamylleucylseryltyrosylglutamylasp…
yptophyltyrosylleucyllysylglycyllysyll…
yllysylvalylvalylprolylarginylserylglu…
ylleucylthreonylleucylarginylaspartylv…
ylglycylglutamylvalylglutaminylleucylt…
nyllysylthreonylhistidylalanylasparagi…
amylprolylprolylvalylglutamylphenylala…
laspartylglutaminylthreonylvalylglutam…
lvalylleucylglutamylcysteinylglutamylv…
alanyllysylvalyllysyltryptophylphenyla…
glutamylisoleucylleucyllysylseryllysyl…
lanylaspartylglycylarginylvalylarginyl…
partylcysteinylthreonylprolylglutamyla…
lthreonylcysteinylaspartylalanyllysyla…
ylcysteinylasparaginylleucylasparaginy…
lglutamylphenylalanylleucylarginylprol…
minylvalylarginylglutamyllysylglutamyl…
lutamylcysteinylglutamylleucylserylarg…
alyllysyltryptophylphenylalanyllysylas…
lysyllysylglycyllysyllysyltyrosylaspar…
ylalanylvalylarginylisoleucylleucylval…
lleucylleucylaspartylaspartylglutamyla…
lutamylvalylarginylthreonylalanylargin…
lthreonylvalylleucylglutamylglutamylgl…
yllysylasparaginylleucylalanylasparagi…
mylthreonylaspartylthreonylisoleucylly…
lseryllysylprolylglycylalanylglutamylv…
glycylaspartylglutamylglutamylisoleucy…
inyltyrosylglutamylisoleucylleucylthre…
ylisoleucylleucylvalylisoleucylglutami…
lutamylaspartylalanylglycylasparaginyl…
eucylprolylserylserylarginylthreonylas…
tidylglutamylleucylalanylalanylglutamy…
lylglutaminylasparaginylleucylglutamyl…
yllysylalanylglutamylphenylalanylvalyl…
utamylserylphenylalanylprolylvalylglut…
laspartyllysylthreonylleucylglutamylse…
ylvalylisoleucylalanylaspartylglycylly…
llysylaspartylalanylthreonylleucylglut…
yltyrosylvalylvalylmethionylvalylglycy…
nylhistidylleucylthreonylvalylisoleucy…
lvalylvalylprolylleucyllysylaspartylth…
aminylglutaminylglutamylvalylvalylphen…
lvalylasparaginylthreonylglutamylglycy…
enylalanylarginylasparaginylglutamylgl…
partylserylseryllysyltyrosylisoleucyli…
ylleucylvalyltyrosylthreonylleucylargi…
stidylleucylaspartylaspartylglutaminyl…
valylserylleucylthreonylasparaginylhis…
ylvalyllysylserylalanylalanylasparagin…
mylglutamylaspartylleucylarginylisoleu…
partylisoleucylglutamylthreonylmethion…
nylphenylalanyltryptophylcysteinyllysy…
aginylvalylthreonylleucyllysyltryptoph…
tamylglutamylvalylprolylphenylalanylas…
yrosylarginylvalylaspartyllysyltyrosyl…
lisoleucyllysylaspartylcysteinylglycyl…
lycylglutamyltyrosylisoleucylvalylthre…
ysylserylvalylalanylglutamylleucylleuc…
rolylthreonylglutamylphenylalanylvalyl…
tylglutaminylthreonylvalylthreonylglut…
nylvalylphenylalanylserylcysteinylglut…
ylalanylasparaginylvalyllysyltryptophy…
inylglutamylisoleucyllysylglutamylglyc…
lglutamyllysylaspartylglycylserylisole…
soleucyllysylaspartylcysteinylarginyll…
nylglutamyltyrosylalanylcysteinylglycy…
erylarginylalanylarginylleucylphenylal…
rolylvalylglutamylisoleucylisoleucylar…
isoleucylleucylglutamylalanylprolylgly…
anylleucylalanylglutamylleucylasparagi…
alylglutaminyltryptophylleucylarginyla…
valylvalylglutaminylglycylaspartyllysy…
ylserylglutamylglycyllysylisoleucylhis…
ylcysteinylaspartylisoleucyllysylproly…
tamyltyrosylarginylphenylalanylisoleuc…
lanylarginylalanyllysylleucylglutamyll…
soleucyllysylthreonylalanylaspartylglu…
rtylvalylglycyllysylprolylleucylthreon…
spartylalanyltyrosylprolyllysylalanylg…
ylalanyllysylglutamylasparaginylglutam…
eonylisoleucylaspartylthreonylthreonyl…
ylphenylalanylarginylisoleucylleucylgl…
llysylglycylarginyltyrosyllysylisoleuc…
ysylhistidylglycyllysylalanylglutamylg…
ylleucyllysylvalylisoleucylaspartylval…
araginylleucylglutamylvalylthreonylglu…
ycylglutamylvalylserylleucylalanyltryp…
hreonylaspartylglycylglycylseryllysyli…
valylglutamylarginylarginylaspartyliso…
tophylvalylleucylalanylthreonylasparty…
lglutamylphenylalanylthreonylvalylthre…
ylglycylvalylglutamyltyrosylleucylphen…
nylasparaginylarginylvalylglycylthreon…
threonylaspartylasparaginylprolylvalyl…
sylaspartylvalylprolylglycylprolylprol…
leucylthreonylaspartylvalylasparaginyl…
leucylthreonyltryptophylglutamylprolyl…
glycylalanylglutamylisoleucylthreonyla…
amylleucylarginylaspartyllysylthreonyl…
rtylthreonylalanylmethionylthreonylval…
ylserylalanylthreonylvalylthreonylaspa…
nylglutamyltyrosylserylphenylalanylarg…
araginylarginylisoleucylglycylvalylgly…
onylprolylphenylalanylvalyllysylvalyla…
larginylprolylserylprolylprolylvalylas…
partylglutaminylthreonylglutaminylsery…
ptophylglutamylprolylprolylleucyllysyl…
eucylleucylglycyltyrosylisoleucylisole…
lglutamylglycyllysylaspartylasparaginy…
lasparaginylmethionyllysylleucylvalylp…
ysylvalylthreonylglycylleucylglutamyll…
ucyltyrosylarginylvalylserylalanylglut…
ylserylaspartylprolylserylglutamylisol…
ylalanylaspartylaspartylalanylphenylal…
ionylaspartylleucylserylalanylphenylal…
ylvalylisoleucylvalylprolylasparaginyl…
cylvalylprolylserylthreonylglycyltyros…
threonyltryptophylcysteinylphenylalany…
amylthreonylglycylaspartylarginylvalyl…
rylalanyltyrosylalanylglutamylleucylva…
larginylserylaspartyllysylglycylisoleu…
glutamylasparaginylarginylvalyllysylth…
soleucylaspartylvalylasparaginylvalyli…
nylprolyllysylglutamylleucyllysylpheny…
nyllysylaspartylserylvalylhistidylleuc…
rolylaspartylaspartylaspartylglycylgly…
yrosylvalylvalylglutamyllysylarginylgl…
ltryptophylthreonyllysylvalylmethionyl…
partylleucylglutamylphenylalanylthreon…
taminylglycyllysylglutamyltyrosylleucy…
nylarginylasparaginyllysylcysteinylgly…
tyrosylvalylaspartylglutamylprolylvaly…
rolylalanylthreonylvalylprolylaspartyl…
llysyltryptophylarginylaspartylarginyl…
ucylphenylalanylleucylthreonyltryptoph…
nylaspartylglycylglycylserylarginyliso…
lylglutamylarginylcysteinylprolylargin…
lvalylalanylcysteinylglycylglutamylpro…
methionylglutamylvalylthreonylglycylle…
tophyltyrosylalanyltyrosylarginylvalyl…
ylglutaminylglycylalanylseryllysylprol…
lglutamylisoleucylglutaminylalanylvaly…
alanylprolylglutamylisoleucylphenylala…
ucylalanylglycylleucylthreonylvalyllys…
lglutamylleucylprolylalanylthreonylval…
prolyllysylisoleucylthreonyltryptophyl…
lisoleucylleucyllysylglutaminylasparty…
ucylglutamylasparaginylvalylprolyllysy…
leucylvalylaspartylseryllysylarginylse…
rosylisoleucylisoleucylglutamylalanylv…
arginylalanylthreonylalanylvalylvalylg…
spartyllysylprolylglycylprolylprolylal…
ucylthreonylaspartylvalylthreonylaspar…
eucylthreonyltryptophylasparaginylprol…
ylglycylseryllysylisoleucylthreonylasp…
ginylarginylalanylthreonylaspartylsery…
ylleucylserylserylthreonylvalyllysylas…
yllysylalanylthreonyllysylleucylisoleu…
rosylisoleucylphenylalanylarginylvalyl…
ionyltyrosylglycylalanylglycylglutamyl…
lylisoleucylthreonylalanyllysyltyrosyl…
lprolylglycylprolylprolylthreonylargin…
isoleucylthreonyllysylaspartylalanylva…
cysteinylglutamylprolylaspartylasparty…
leucylthreonylglycyltyrosyltryptophylv…
olylaspartylthreonylaspartyllysyltrypt…
yllysylmethionylprolylvalyllysylaspart…
yllysylglycylleucylthreonylasparaginyl…
alanylarginylvalylleucylalanylglutamyl…
glycyllysylprolylseryllysylserylthreon…
eucyllysylaspartylprolylisoleucylaspar…
ylglycyllysylprolylthreonylvalyllysyla…
lvalylarginylleucylasparaginyltryptoph…
ylaspartylglycylglycylalanyllysylisole…
cylglutamylmethionylleucyllysylthreony…
tophylvalylarginylvalylalanylglutamylg…
taminylhistidylleucylleucylprolylglycy…
minylglutamyltyrosylserylphenylalanyla…
ginyllysylalanylglycylglutamylserylglu…
aspartylprolylvalylleucylcysteinylargi…
prolylserylprolylprolylarginyltryptoph…
aginylisoleucylthreonyllysylasparaginy…
ryptophylthreonylvalylprolylglutamylly…
soleucylthreonylasparaginyltyrosylisol…
tylvalylarginylarginyllysylglycyltrypt…
lthreonylthreonylvalyllysylaspartylthr…
eonylprolylleucylthreonylglutamylglycy…
larginylvalylalanylalanylglutamylaspar…
ylserylaspartyltyrosylthreonylglutamyl…
leucylalanyllysylaspartylthreonylpheny…
prolylprolyltyrosylalanylleucylalanylv…
arginylhistidylvalylaspartylleucyllysy…
lasparaginylaspartylglycylglycylarginy…
rosylvalylisoleucylglutamyllysyllysylg…
rginyltryptophylvalyllysylalanylglycyl…
rtylcysteinylasparaginylphenylalanylar…
eucylglutamylglycylthreonylglutamylval…
alylarginylalanylglutamylasparaginylgl…
ylprolylserylglutamylprolylthreonylglu…
lutamylaspartylprolylthreonylserylprol…
rtylleucylhistidylvalylthreonylasparty…
oleucylalanylisoleucylalanyltryptophyl…
aginylglycylglycylserylprolylisoleucyl…
glutamylmethionylcysteinylprolylvalylg…
lmethionylarginylvalylasparaginylseryl…
leucyllysylphenylalanyllysylvalylgluta…
partyllysylglutamyltyrosylvalylleucyla…
ginylalanylisoleucylglycylvalylserylgl…
erylglutamylasparaginylvalylvalylalany…
yllysylprolylthreonylisoleucylaspartyl…
tylisoleucylisoleucylvalylisoleucylglu…
isoleucylprolylvalylprolylphenylalanyl…
threonylvalylseryltryptophylhistidylly…
lysylalanylserylaspartylarginylleucylt…
artylhistidylisoleucylserylalanylhisti…
rylvalylarginylalanylaspartylalanylgly…
lthreonylleucylglutamylasparaginyllysy…
nylserylisoleucylasparaginylvalyllysyl…
cylprolylcysteinyllysylaspartylisoleuc…
threonyllysylserylserylcysteinyllysyll…
ylprolylglutamylphenylalanylaspartylgl…
ucylhistidyltyrosylvalylleucylglutamyl…
rginylarginylthreonyltyrosylisoleucylp…
mylasparaginyllysylleucylseryltryptoph…
soleucylprolylasparaginylglycylglutamy…
inylvalyllysylalanylvalylasparaginylly…
yrosylisoleucylglutamylleucyllysylaspa…
utaminylaspartylprolyllysylglutaminylp…
laspartylvalylglutamylvalylhistidylasp…
lalanylmethionylthreonylisoleucylthreo…
ltyrosylaspartylglycylglycylseryllysyl…
eucylisoleucylglutamyllysylisoleucylal…
nyltryptophyllysylarginylcysteinylaspa…
rolylisoleucylleucylthreonyltyrosylthr…
lglutamylglycyllysylglutamyltyrosylglu…
nylalanylglutamylasparaginylalanylalan…
lserylarginylalanylthreonylprolylproly…
olylisoleucylaspartylalanylprolyllysyl…
serylleucylglutamylvalyllysylarginylgl…
leucylaspartylalanylserylisoleucylsery…
onylisoleucylthreonyltryptophylisoleuc…
alylisoleucylvalylprolylglutamylglutam…
lanylprolylleucylvalylarginylarginylar…
inylglutamylglutamylglutamylprolylphen…
onylglutaminylarginylleucylserylisoleu…
ylglycylglutamylserylglutaminylleucyla…
ylarginylprolylaspartylhistidylglycyll…
valylglutamylasparaginylaspartylhistid…
rolylcysteinylthreonylvalylserylvalyll…
olylprolylisoleucylasparaginylphenylal…
ylisoleucylarginyllysylthreonylserylva…
utamylprolylprolylleucylaspartylaspart…
lisoleucylasparaginyltyrosylthreonylle…
threonyllysylprolylaspartylserylglutam…
onylserylthreonylleucylarginylhistidyl…
onyllysylleucylisoleucylglutamylglycyl…
nylarginylvalylarginylalanylglutamylas…
rolylglycylprolylprolylcysteinylvalyls…
ylaspartylprolylphenylalanylglycylprol…
llysylprolylisoleucylvalylglutamylaspa…
rylmethionylleucylvalyllysyltryptophyl…
tylasparaginylglycylserylprolylisoleuc…
ylglutamyllysylarginylglutamylvalylasp…
phylserylarginylvalylasparaginyllysyls…
ucyllysylalanylasparaginylvalylasparty…
ucylthreonyltyrosylvalylphenylalanylar…
paraginylalanylalanylglycylprolylglycy…
serylaspartylprolyllysylthreonylalanyl…
lprolylprolylglycylprolylprolylisoleuc…
lthreonylserylserylthreonylthreonyliso…
hylglutamylprolylprolylalanylphenylala…
tamylisoleucylvalylglycyltyrosylphenyl…
eucylvalylglycylthreonylasparaginyllys…
reonylglutamyllysylmethionylisoleucyll…
reonylvalyllysylglutamylisoleucylargin…
yllysylleucylarginylvalylserylalanylva…
tamylglycylprolylprolylglycylglutamylt…
lvalylalanylglutamylprolylglutaminylgl…
ylleucylaspartylvalylserylvalyllysylgl…
cylmethionylalanylglycyllysylthreonyll…
lylvalylthreonylglycylarginylprolylval…
lthreonyllysylglutamylglutamylglycylgl…
ginylvalylvalylisoleucylaspartylaspara…
lutamylleucylisoleucylisoleucyllysylas…
tylhistidylglycylarginyltyrosylvalylis…
ginylserylcysteinylglycylseryllysylphe…
alylglutamylvalylphenylalanylaspartylv…
partylleucyllysylprolylvalylvalylthreo…
cysteinylleucylleucylasparaginyltrypto…
rtylaspartylglycylglycylserylglutamyli…
soleucylisoleucylglutamylarginyllysyla…
threonyltryptophylarginylglutaminylpro…
larginylseryllysylcysteinylaspartyliso…
tamylglycylglutaminylglutamyltyrosylly…
lalanyllysylasparaginyllysylphenylalan…
valylglutamylisoleucylglycylprolylisol…
lleucylglycylprolylprolylthreonylseryl…
tyrosylthreonylglutamylarginylglutamin…
onylleucylaspartyltryptophyllysylgluta…
cylglycylserylprolylisoleucylglutaminy…
tamyllysylarginylarginylhistidylaspart…
utamylarginylvalylasparaginyllysylargi…
eonylserylphenylalanylleucylvalylgluta…
lhistidylglutaminylmethionyltyrosylglu…
lanylvalylasparaginylglutamylisoleucyl…
rylleucylprolylleucylasparaginylvalylv…
rtylglutamylvalylprolylprolylthreonyli…
ylvalylarginylglycylaspartylthreonylis…
lutamylprolylvalylhistidylisoleucylpro…
lleucylprolylmethionylprolyllysylisole…
araginylglutamylthreonylvalylisoleucyl…
alanylleucylglutaminylisoleucylthreony…
inylserylglutamylalanyllysylthreonylgl…
ylalanylvalylarginylglutamylaspartylly…
ylthreonylalanylserylasparaginylarginy…
arginylasparaginylvalylhistidylvalylgl…
olylserylprolylprolylarginylasparaginy…
soleucyllysylalanylglutamylserylcystei…
spartylalanylprolylleucylaspartylaspar…
eucylthreonylhistidyltyrosylvalylisole…
nylserylarginyllysyllysylalanylglutamy…
eonylasparaginylthreonylalanylvalylglu…
ucyltryptophyllysylleucylisoleucylprol…
lglutamylphenylalanylarginylvalylargin…
lglycylisoleucylserylaspartylglutamylc…
lvalylisoleucylglutaminylaspartylproly…
olylprolylglycyllysylprolyllysylvalyll…
ylserylmethionylleucylvalylseryltrypto…
tylasparaginylglycylglycylserylprolyli…
phylleucylglutamyllysylarginylglutamyl…
ptophylserylarginylvalylserylarginylal…
ylglycylleucyllysylglycylvalylglutamyl…
rginylleucylleucylglutamylglycylvalyll…
ginylalanylmethionylalanylisoleucylasp…
glycylprolylprolylserylglutamylprolyls…
ylglycylaspartylprolylisoleucylphenyla…
serylcysteinylprolylglutamylvalyllysyl…
lisoleucylserylleucylglycyltryptophyll…
glycylglycylserylprolylisoleucyllysylg…
ethionylglutaminylglutamylglutamylglyc…
llysylarginylvalylasparaginylglutamylp…
reonylthreonylcysteinylglutamylcystein…
lysylglutamylleucylarginyllysyltyrosyl…
lalanylvalylasparaginylglutamylalanylg…
ylaspartylthreonylthreonylglycylglutam…
rtylisoleucylglutaminylglutamylglutamy…
leucylaspartylisoleucylglycylalanylglu…
cysteinyllysylalanylglycylserylglutami…
lanylvalylisoleucyllysylglycylarginylp…
ryptophylglutamylphenylalanylaspartylg…
hionyllysylaspartylglycylvalylhistidyl…
rtylalanylglutaminylleucylglutamylthre…
erylvalylisoleucylisoleucylisoleucylpr…
rylhistidylthreonylglycyllysyltyrosyls…
araginyllysylalanylglycylglutaminyllys…
larginylvalyllysylvalylmethionylaspart…
laspartylleucyllysylvalylserylaspartyl…
cysteinylarginylleucylseryltryptophyll…
aspartylglycylglycylaspartylarginyliso…
cylglutamyllysylarginylthreonylisoleuc…
ylthreonyllysylvalylasparaginylprolyla…
threonylphenylalanylvalylvalylprolylas…
aminylglutaminyltyrosylphenylalanylphe…
lutamylasparaginylarginylphenylalanylg…
ylglutamylthreonylisoleucylglutaminyla…
aspartylprolylisoleucyltyrosylprolylpr…
sylleucyllysylisoleucylglycylleucyliso…
nylvalylhistidylleucylseryltryptophyll…
artylglycylglycylserylprolylvalylthreo…
tamylcysteinylleucylalanyltryptophylas…
ysyllysylglutamylalanyltryptophylargin…
ylarginylaspartylvalylglutamylglutamyl…
lvalylglutamylaspartylleucylvalylgluta…
mylphenylalanylarginylvalyllysylalanyl…
alylseryllysylprolylserylalanylthreony…
cysteinylglutaminylarginylprolylaspart…
ylaspartylleucyllysylglutamylphenylala…
utamylglycylthreonylasparaginylvalylas…
soleucyllysylglycylvalylprolylphenylal…
ptophylphenylalanyllysylalanylprolylpr…
inyllysylglutamylprolylvalylleucyltyro…
araginyllysylleucylvalylvalylaspartyla…
cylvalylisoleucylprolylglutaminylseryl…
glycylleucyltyrosylthreonylisoleucylth…
inylleucylglycylthreonylalanylseryllys…
araginylvalylleucylglycylarginylprolyl…
isoleucyllysylphenylalanylglutamylsery…
methionylthreonylleucylseryltryptophyl…
ylaspartylglycylglycylseryllysylisoleu…
soleucylglutamyllysylarginylglutamylal…
tryptophylvalylhistidylvalylserylseryl…
lthreonyltyrosylthreonylisoleucylproly…
tidylglutamyltyrosylvalylphenylalanyla…
minylasparaginyllysyltyrosylglycylisol…
rtylserylglutamylprolylglutamylthreony…
ylalanylserylvalylprolylglycylalanylpr…
lserylserylvalylthreonylarginylasparag…
raginyltryptophylglutamylglutamylproly…
lserylprolylvalylthreonylglycyltyrosyl…
sylaspartylthreonylthreonylseryllysyla…
paraginylarginylaspartylprolylisoleucy…
glycylvalylseryltyrosyllysylvalylthreo…
cylserylaspartyltyrosylglutaminylpheny…
leucylasparaginylalanylalanylglycylval…
ylserylaspartylprolylalanylthreonylala…
anylprolylprolylglycylprolylprolylphen…
artyltryptophylthreonyllysylserylseryl…
hylserylprolylprolylleucyllysylasparty…
lglycyltyrosylisoleucylvalylglutamylty…
ylglutamylglutamyltryptophylglutamylly…
valylarginylglycylthreonyllysylleucylv…
lutamylglycylalanylphenylalanyltyrosyl…
lanylvalylasparaginylisoleucylalanylgl…
ycylglutamylvalylthreonylaspartylvalyl…
rtylarginylleucylvalylserylprolylaspar…
anylserylvalylarginylaspartylarginylis…
ylglycylvalylisoleucylarginylisoleucyl…
cyllysylprolylprolylprolylthreonylvaly…
onylasparaginylglutamylarginylthreonyl…
lthreonylisoleucylglutamylthreonylthre…
ethionylvalylisoleucyllysylasparaginyl…
idylglutaminylglycylvalyltyrosylseryll…
utamylalanylglycylglutamylarginyllysyl…
laspartylvalylleucylaspartylvalylproly…
lylphenylalanylleucylalanylhistidylasp…
utamylserylcysteinyllysylleucylthreony…
lutamylaspartylaspartylglycylglycylser…
ltyrosylvalylisoleucylglutamyllysylarg…
inylalanyltryptophylthreonylprolylvaly…
ylarginylglutaminylasparaginylalanylth…
oleucylglutaminylglycyllysylalanyltyro…
soleucylalanylalanylglutamylasparaginy…
lprolylphenylalanylvalylglutamylthreon…
leucylarginylglutamylprolylisoleucylth…
lylglutamylaspartylleucylglutamylvalyl…
raginylthreonylvalylthreonylleucylthre…
yllysyltyrosylaspartylglycylglycylsery…
nyltyrosylvalylleucylglutamylserylargi…
tamyllysylphenylalanylhistidyllysylval…
ginylleucylleucylserylarginyllysyltyro…
sylglutamylglycylaspartylthreonyltyros…
lanylvalylasparaginylisoleucylvalylgly…
phenylalanylcysteinylthreonyllysylprol…
partylglutamylleucylalanylprolylprolyl…
lphenylalanylarginylaspartyllysylleucy…
lglutamylalanylphenylalanylalanylleucy…
lycyllysylprolyllysylprolyllysylvalyls…
rtylglutamylalanylaspartylvalylleucylg…
nylhistidylisoleucyllysylthreonylthreo…
leucylglutamyllysylisoleucyllysylalany…
yllysyltyrosylcysteinylvalylvalylvalyl…
cylserylarginyllysylglycylphenylalanyl…
valylvalylaspartylhistidylprolylglycyl…
erylphenylalanylaspartylglutamylvalylt…
lvalylisoleucylseryltryptophyllysylpro…
ylglycylseryllysylisoleucylthreonylasp…
utamyllysyllysylglutamylvalylglycyllys…
rolylvalylthreonylserylalanylserylalan…
ylvalylseryllysylleucylleucylglutamylg…
henylalanylarginylisoleucylhistidylala…
glycylisoleucylserylaspartylprolylleuc…
ysylalanyllysylaspartylarginylphenylal…
lprolylaspartylglutaminylprolylisoleuc…
llysylaspartylserylalanylleucylvalylth…
lylhistidylaspartylglycylglycyllysylpr…
osylisoleucylleucylglutamyllysylarginy…
larginyltryptophylalanylarginylvalylth…
istidylprolyltyrosylthreonyllysylpheny…
ucylleucylglutamylglycylcysteinylgluta…
inylvalylserylalanylglutamylasparaginy…
ycylaspartylprolylserylprolylprolylser…
llysylaspartylprolylisoleucylalanyllys…
aginylprolylglutamylalanylisoleucylasp…
aginylserylvalylaspartylleucylthreonyl…
inylhistidylaspartylglycylglycylseryll…
leucylvalylglutamyltyrosylglutaminylly…
myltryptophylarginylarginylalanylaspar…
lserylcysteinylprolylglutamylthreonyll…
leucylarginylaspartylglycylglutaminylt…
nylvalylleucylalanylvalylasparaginylal…
ylprolylalanylhistidylvalylprolylgluta…
tylarginylleucylglutamylprolylprolylgl…
alanylasparaginylmethionylalanylarginy…
llysylvalylglycylaspartylthreonylleucy…
soleucyllysylglycylvalylprolylphenylal…
hyllysyllysylglutamylaspartylarginylas…
ylarginylisoleucylaspartylvalylthreony…
lutamylisoleucylarginylasparaginylalan…
cylglycylisoleucyltyrosylserylleucylth…
lalanylglycylseryllysylthreonylvalylse…
aspartyllysylprolylglycylprolylprolyla…
rylglutamylisoleucylarginyllysylaspart…
yltryptophyllysylglutamylprolylleucyla…
ylisoleucylthreonylasparaginyltyrosylv…
rtylvalylalanylserylalanylglutaminyltr…
lthreonylseryllysyllysyllysylserylhist…
leucylasparaginylglutamylglycylasparag…
anylarginylvalylalanylalanylglutamylas…
inylglycylprolylphenylalanylvalylgluta…
yllysylalanylleucylaspartylprolylleucy…
olyllysylaspartylleucylhistidylhistidy…
eonylglutamylvalylserylleucylvalyltryp…
larginylaspartylglycylglycylserylproly…
ylvalylglutamyltyrosylglutaminylglutam…
spartyltryptophylisoleucyllysylphenyla…
raginylleucylglutamylcysteinylvalylval…
taminylglycyllysylthreonyltyrosylargin…
ylglutamylasparaginylisoleucylvalylgly…
threonylthreonylisoleucylprolylisoleuc…
yllysylleucylvalylprolylprolylserylval…
eucylisoleucylglutamylglycylleucylvaly…
onylvalylarginylphenylalanylprolylalan…
lylprolylvalylprolylthreonylalanyllysy…
glycylserylglutamylisoleucyllysylthreo…
hreonylvalylglutamylthreonylaspartylas…
lleucylthreonylisoleucyllysylasparagin…
rtylthreonylglycylglutamyltyrosylgluta…
araginylalanylalanylglycylseryllysylth…
lthreonylvalylleucylaspartylvalylproly…
olylisoleucylasparaginylisoleucylleucy…
lhistidylmethionylthreonylisoleucylser…
ysylaspartylaspartylglycylglycylserylp…
ylisoleucylvalylglutamyllysylglutaminy…
ylthreonyltryptophylglycylvalylvalylse…
yllysylleucyllysylisoleucylprolylhisti…
inylglutamyltyrosylvalylphenylalanylar…
raginyllysylisoleucylglycylvalylglycyl…
onylprolylthreonylvalylalanyllysylhist…
lylserylprolylprolylglycyllysylprolylv…
hreonylglutamylasparaginylalanylalanyl…
lleucylprolyllysylserylaspartylglycylg…
ycyltyrosyltyrosylmethionylglutamylarg…
cyllysyltryptophylvalylarginylvalylasp…
lalanylaspartylleucyllysylphenylalanyl…
osylglutamylglycylasparaginylthreonylt…
lylphenylalanylalanylglutamylasparagin…
lprolylserylprolylserylserylaspartylpr…
ginylprolylisoleucyllysylprolylprolylg…
ylprolyllysylleucyllysylaspartyllysyls…
partylleucylvalyltryptophylthreonyllys…
ycylserylprolylisoleucylleucylglycylty…
taminyllysylprolylglycylthreonylalanyl…
nylisoleucylasparaginyllysylaspartylgl…
nylcysteinylalanylphenylalanylarginylv…
amylglycylasparaginylglutamyltyrosylar…
sylalanylalanylasparaginylisoleucylval…
larginylglutamylleucylalanylglutamylse…
lisoleucylleucylhistidylprolylprolylgl…
lylthreonylcysteinylarginylaspartylval…
lglycylglutaminylthreonylisoleucylargi…
llysylglycylarginylprolylglutamylproly…
lthreonyllysylglutamylglycyllysylvalyl…
nylvalylaspartylleucylisoleucylglutami…
glutamylleucylglutaminylisoleucyllysyl…
artylhistidylglycyllysyltyrosylisoleuc…
nylserylserylglycylhistidylalanylgluta…
lasparaginylvalylleucylaspartylarginyl…
ylasparaginylleucyllysylvalylthreonyla…
lasparaginylcysteinylthreonylisoleucyl…
rolylleucylaspartylasparaginylglycylgl…
sparaginylphenylalanylisoleucylvalylgl…
raginylglutaminyllysylglycyltryptophyl…
tylvalylthreonyllysylarginylleucylisol…
ucylalanylasparaginylasparaginylglutam…
valylcysteinylalanylglutamylasparaginy…
hreonylisoleucylglutamylthreonyllysylt…
soleucylasparaginylprolylisoleucylaspa…
ylglutamylasparaginylleucylhistidyliso…
lthreonylphenylalanylvalyltyrosylleucy…
laspartyltyrosylaspartylglycylglycylse…
sylhistidylvalylglutamylarginylarginyl…
tyltryptophylglutamylarginylvalylhisti…
utamylthreonylhistidyltyrosylmethionyl…
lutamylasparaginylglutaminylisoleucylt…
lylglutaminylthreonyllysylasparaginylg…
artyltryptophylvalyllysylthreonylgluta…
amylaspartylleucylglutaminyllysylproly…
ylserylglycylvalylleucylthreonylvalyll…
leucylarginylleucylglutamylalanylglycy…
lalanylprolylglutamylvalylalanyltrypto…
tylalanylthreonylaspartylleucylthreony…
lisoleucylaspartylthreonylarginylalany…
lserylleucylthreonyllysylalanyllysylar…
tyrosylvalylvalylthreonylalanylthreony…
ylphenylalanylvalylalanyltyrosylalanyl…
aspartyllysylprolylglycylprolylvalylar…
lvalylaspartylvalylserylserylaspartyla…
yltryptophylaspartylprolylprolylglutam…
inylglutamylisoleucylglutaminylasparag…
ysylcysteinylglutamylthreonyllysylargi…
eonyltyrosylserylalanylthreonylvalylle…
eonylvalylthreonylarginylleucylisoleuc…
tyrosylisoleucylphenylalanylarginylval…
ysylisoleucylglycylthreonylglycylproly…
olylvalylisoleucylalanyllysylthreonyll…
larginylprolylaspartylprolylprolylglut…
ylglutamylglutamylmethionylthreonylval…
rolylglutamyltyrosylaspartylglycylglyc…
tyrosylphenylalanylleucylglutamyllysyl…
onylarginyltryptophylvalylprolylvalyla…
prolylglutamylarginylarginylmethionyll…
lleucylprolylaspartylhistidylglutamylt…
valyllysylalanylglutamylasparaginylglu…
glutamylprolylserylleucylprolylserylar…
artylprolylisoleucylglutamylprolylprol…
inylphenylalanylarginylvalylvalylaspar…
ylisoleucylthreonylleucylglycyltryptop…
artylglycylglycylalanylprolylisoleucyl…
tamylmethionylarginylprolyllysylisoleu…
spartylglutamylglycyltryptophyllysylar…
ylalanylglutaminylleucylvalylarginylly…
lthreonylserylleucylaspartylglutamylas…
lutamylphenylalanylarginylvalylcystein…
inylvalylglycylisoleucylglycylarginylp…
mylalanylisoleucyllysylprolyllysylglut…
olylglutamylisoleucylaspartylleucylasp…
ylleucylvalylisoleucylvalylarginylalan…
inylleucylphenylalanylalanylisoleucylv…
lprolyllysylvalylthreonyltryptophylarg…
ylasparaginylvalylvalylarginyllysylgly…
ylaspartylthreonylmethionylalanylpheny…
paraginylserylthreonylarginylaspartyla…
leucylthreonylleucylvalylasparaginylpr…
valylphenylalanylvalylasparaginylvalyl…
rolylglycylprolylvalylserylaspartylleu…
onyllysylthreonylserylcysteinylhistidy…
olylglutamylasparaginylaspartylglycylg…
stidyltyrosylisoleucylvalylglutamyllys…
nyllysylthreonyltryptophylserylthreony…
syllysylthreonylserylphenylalanylhisti…
lylprolylglycylasparaginylglutamyltyro…
hreonylalanylvalylasparaginylglutamylt…
threonylaspartylvalylprolyllysylprolyl…
lleucylserylglutamylprolylaspartylprol…
lanylthreonylglutamylmethionylthreonyl…
leucylalanyltryptophylleucylprolylprol…
alanyllysylisoleucylaspartylglycyltyro…
ginylglutamylglutamylglutamylglutaminy…
hylthreonylglutamyltyrosylserylvalylva…
lylvalylthreonylglycylleucyllysylgluta…
ylalanylarginylvalylalanylalanylarginy…
erylleucylprolylarginylglutamylalanylg…
anyllysylglutamylglutaminylleucylleucy…
thionylprolylglutamylglutaminylisoleuc…
llysyllysylleucylarginylisoleucylgluta…
lysylprolylhistidylprolylthreonylcyste…
glutamylaspartylglutamylvalylvalylthre…
alylhistidyllysylalanylaspartylserylse…
leucyllysylaspartylvalylthreonylarginy…
osylserylleucylthreonylalanylglutamyla…
spartylthreonylglutaminyllysylisoleucy…
tylalanylprolylglycylprolylprolylgluta…
ylisoleucylserylaspartylisoleucylaspar…
ylleucylseryltryptophylhistidylisoleuc…
lglycylserylasparaginylisoleucylthreon…
lutamyllysylcysteinylaspartylvalylsery…
ylthreonylalanylleucylalanylserylvalyl…
arginylvalylglycyllysylleucylisoleucyl…
ylisoleucylphenylalanylarginylvalylarg…
lphenylalanylglycylisoleucylserylgluta…
ysylmethionylvalylalanylglutaminylphen…
ylprolylserylglutamylprolyllysylaspara…
lvalylasparaginyllysylaspartylcysteiny…
yptophylaspartylarginylprolylaspartyls…
isoleucylisoleucylglycyltyrosylleucyli…
larginylasparaginylserylleucylleucyltr…
aspartylthreonylleucylvalylarginylsery…
inylalanylglycylleucylvalylglutamylgly…
alanylarginylisoleucyltyrosylalanylleu…
lserylprolylprolylseryllysylprolylthre…
nylarginylmethionylprolylvalylaspartyl…
ylvalylisoleucylaspartylvalylthreonyll…
oleucyltryptophylalanylarginylprolylly…
llysylisoleucylisoleucylglycyltyrosylp…
inyllysylleucylprolylglycylaspartyllys…
paraginylthreonylalanylprolylhistidylg…
lutamylglutamyltyrosylthreonylalanylth…
ysylalanylglutaminyltyrosylglutaminylp…
anylarginylthreonylalanylvalylasparagi…
lutamylprolylserylaspartylprolylvalylt…
lasparaginylvalylprolylprolylarginylis…
ylmethionyllysylserylleucylleucylthreo…
paraginylvalylcysteinylleucylaspartyla…
llysylprolylmethionylprolylthreonylval…
glycylthreonylleucylleucyllysylprolyla…
thionylalanylmethionylglutaminylarginy…
leucylglutamylleucylphenylalanylserylv…
serylglycylaspartyltyrosylthreonylisol…
nylserylserylglycylseryllysylserylalan…
valylleucylaspartyllysylprolylglycylpr…
eucylasparaginyllysylmethionyltyrosyls…
eucylseryltryptophylglutamylprolylprol…
lserylglutamylisoleucylthreonylasparag…
sylarginylglutamylthreonylserylarginyl…
utaminylvalylserylalanylthreonylvalylp…
lserylvalylglutamyllysylleucylisoleucy…
sylglutaminylphenylalanylarginylisoleu…
yllysyltyrosylglycylvalylglycylasparty…
tamylprolylalanylisoleucylalanyllysyla…
ylprolylglycylarginylcysteinylaspartyl…
raginylisoleucylthreonyllysylaspartylh…
ryptophyllysylprolylprolylalanylaspart…
oleucylthreonylglycyltyrosylleucylleuc…
nylglutaminylalanylvalylasparaginyltry…
larginyllysylprolylisoleucylisoleucylg…
anylthreonylglycylleucylglutaminylglut…
utamylphenylalanylarginylvalylthreonyl…
ylglycylprolylglycyllysylprolylserylas…
yrosylalanylarginylaspartylprolylgluta…
lprolylalanylphenylalanylprolyllysylva…
rginylserylserylvalylserylleucylserylt…
osylaspartylglycylglycylserylprolyliso…
alylglutamylvalyllysylarginylalanylasp…
phylvalylarginylcysteinylasparaginylle…
ylglutaminyllysylthreonylarginylphenyl…
ucylmethionylglutamylaspartylthreonylg…
nylarginylvalyltyrosylalanylvalylaspar…
rylaspartylprolylserylaspartylvalylpro…
yllysylaspartylisoleucylleucylisoleucy…
histidylaspartylalanylaspartylleucylar…
ucylarginylalanylglycylvalylthreonylme…
lylvalyllysylglycylarginylprolylprolyl…
hylseryllysylprolylasparaginylvalylasp…
lisoleucylglycylleucylaspartylisoleucy…
anylaspartylthreonylphenylalanylleucyl…
valylasparaginyllysyltyrosylaspartylal…
ylthreonylleucylglutamylasparaginylser…
tyrosylthreonylisoleucylvalylvalyllysy…
lycylprolylprolylisoleucylasparaginylv…
ucylseryllysylaspartylserylalanyltyros…
olylprolylisoleucylisoleucylaspartylgl…
ucylasparaginyltyrosylvalylvalylglutam…
mylarginyllysylseryltryptophylserylthr…
ysteinylseryllysylthreonylserylphenyla…
eucylglutamylglutamylglycyllysylserylt…
ylvalylphenylalanylalanylglutamylaspar…
lglycylaspartylprolylglycylglutamylthr…
lalanylserylglutaminylthreonylprolylgl…
ysylvalylarginylserylvalylseryllysylse…
yltryptophyllysyllysylprolylhistidylse…
isoleucylisoleucylglycyltyrosylvalylva…
ylglutamylglutamylasparaginyllysyltryp…
yllysylserylleucylserylleucylglutaminy…
cylthreonylglutamylglycyllysylglutamyl…
alylserylalanylglutamylasparaginylglut…
threonylprolylserylglutamylisoleucylth…
ylaspartylvalylvalylalanylprolylaspart…
ucylprolylaspartylleucylcysteinyltyros…
nylserylasparaginylphenylalanylarginyl…
lysylglycyllysylprolylalanylprolylsery…
ylglutamylaspartylprolylleucylalanylth…
erylvalylglutamylserylserylalanylvalyl…
oleucylvalyltyrosylaspartylcysteinylgl…
cyllysyltyrosylthreonylisoleucylthreon…
glycylthreonyllysylglutamylglycylthreo…
lvalylglycyllysylprolylglycylisoleucyl…
lysylphenylalanylaspartylglutamylvalyl…
ylthreonylleucyllysyltryptophylalanylp…
cylglycylserylglutamylisoleucylthreony…
lutamyllysylarginylaspartylserylvalyla…
lvalylthreonylcysteinylalanylserylalan…
nylphenylalanylarginylvalylthreonylarg…
hionylglutamyltyrosylthreonylphenylala…
sparaginyllysyltyrosylglycylvalylglycy…
amylprolylisoleucylvalylalanylarginylh…
lylprolylaspartylalanylprolylprolylpro…
spartylvalylarginylhistidylaspartylser…
lthreonylaspartylprolyllysyllysylthreo…
threonylglycyltyrosylhistidylleucylglu…
ylasparaginylserylleucylleucyltryptoph…
lthreonylprolylisoleucylarginylmethion…
alylthreonylglycylleucylthreonylglutam…
ylphenylalanylarginylvalylmethionylala…
glycylvalylglycyllysylprolylserylleucy…
lalanylleucylaspartylprolylisoleucylas…
glutamylvalylisoleucylasparaginylisole…
valylthreonylleucylisoleucyltryptophyl…
spartylglycylglycylhistidyllysylleucyl…
glutamyllysylarginylaspartylleucylprol…
llysylalanylasparaginylhistidylvalylas…
ylalanylphenylalanylthreonylvalylthreo…
lglycyllysyltyrosylglutamylphenylalany…
asparaginylthreonylalanylglycylalanyli…
mylserylthreonylglutamylthreonylisoleu…
lutamyltyrosylglutamylalanylprolylthre…
lylthreonylisoleucyllysylaspartylglycy…
glycylaspartylthreonylisoleucylvalylle…
isoleucylleucylglycyllysylprolylleucyl…
llysylalanylglycyllysylaspartylisoleuc…
ylthreonylglutaminylisoleucylthreonyls…
lmethionylleucylthreonylisoleucyllysyl…
partylalanylglycylglutamyltyrosylthreo…
sparaginylprolylphenylalanylglycylthre…
lysylvalylthreonylvalylleucylaspartylv…
rolylvalylglutamylisoleucylserylaspara…
lanylthreonylleucylthreonyltryptophylt…
partylglycylglycylserylprolylisoleucyl…
tamyllysylarginylglutamylthreonylseryl…
ylvalylvalylserylglutamylaspartylisole…
histidylvalylalanylthreonyllysylleucyl…
lglutamyltyrosylisoleucylphenylalanyla…
nylhistidyltyrosylglycyllysylglycylglu…
amylprolylvalyllysylmethionylvalylaspa…
prolylglycylprolylprolylglutamyllysylp…
alylthreonyllysylasparaginylthreonylal…
ylarginylprolylvalylaspartylaspartylgl…
eonylglycyltyrosylhistidylvalylglutamy…
rylleucylarginyltryptophylvalylarginyl…
alylserylaspartylleucylarginylcysteiny…
aminylglutamylglycylserylthreonyltyros…
erylalanylglutamylasparaginylarginylal…
ylserylglutamylalanylserylaspartylsery…
lanylalanyltyrosylprolylprolylglycylpr…
tidylvalylthreonylaspartylthreonylthre…
lalanyltryptophylglycyllysylprolylhist…
ylglutamylisoleucylthreonylglycyltyros…
nyllysylvalylglycylaspartylglutamylala…
threonylthreonylglycylthreonylalanylle…
nylphenylalanylvalylvalylprolylasparty…
myllysyltyrosylasparaginylphenylalanyl…
lasparaginylaspartylalanylglycylvalylg…
ucylprolylaspartylvalylglutamylisoleuc…
onylalanylprolylaspartylphenylalanylgl…
eucylarginylarginylthreonylleucylvalyl…
isoleucylarginylisoleucylphenylalanylv…
ylprolylalanylprolylglutamylvalylthreo…
sparaginylisoleucylasparaginylleucylly…
nylisoleucylglutamylasparaginylthreony…
eucylleucylisoleucylisoleucylprolylglu…
osylaspartylthreonylglycyllysylphenyla…
lglutamylasparaginylprolylalanylglycyl…
lylasparaginylvalylarginylvalylleucyla…
lylleucylasparaginylleucylarginylproly…
ysylaspartylserylvalylthreonylleucylhi…
lleucylisoleucylaspartylglycylglycylse…
nyltyrosylisoleucylvalylglutamyllysyla…
lysylseryltyrosylserylthreonylalanylth…
llysylcysteinylthreonyltyrosyllysylval…
glycylcysteinylglutamyltyrosylphenylal…
ylalanylglutamylasparaginylglutamyltyr…
olylthreonylglutamylthreonylthreonylgl…
utamylalanylprolylserylprolylprolylasp…
lmethionylaspartylisoleucylthreonyllys…
yltryptophylprolyllysylprolyllysylhist…
soleucylthreonylglycyltyrosylvalylisol…
llysylglycylserylaspartylglutaminyltry…
eonylthreonylvalyllysylglycylleucylglu…
raginylleucylthreonylglutamylglycylglu…
lanylglutaminylvalylmethionylalanylval…
ylserylalanylprolylarginylglutamylsery…
sylglutamylglutaminylthreonylmethionyl…
eucylarginylglycylisoleucyltyrosylglut…
yllysylalanylglycylaspartylasparaginyl…
lprolylvalylleucylglycylarginylprolyll…
tophyllysyllysylglycylaspartylglutamin…
eonylglutaminylarginylvalylasparaginyl…
lalanylthreonylserylthreonylisoleucyll…
lglutamylcysteinylvalylarginylserylasp…
leucylthreonylalanylarginylasparaginyl…
ycylaspartylvalylisoleucylthreonylisol…
lisoleucylprolylglycylprolylprolylthre…
lalanylaspartylglutamylvalylserylseryl…
enylalanylseryltryptophylaspartylproly…
lycylglycylvalylprolylisoleucylserylas…
ethionylarginylglutaminylthreonylaspar…
alylglutamylleucylalanylthreonylthreon…
onyltyrosyllysylalanylthreonylarginyll…
utamyltyrosylglutaminylphenylalanylarg…
aginylarginyltyrosylglycylvalylglycylp…
anyltryptophylisoleucylvalylalanylaspa…
ylvalylprolylglycylprolylprolylglycylt…
lalanylvalylthreonyllysylaspartylseryl…
tophylhistidylglutamylprolylleucylsery…
leucylleucylglycyltyrosylhistidylvalyl…
asparaginylglycylisoleucylleucyltrypto…
ylalanylleucylvalylprolylglycylasparag…
serylglycylleucylthreonylaspartylglycy…
ylalanylarginylvalylisoleucylalanylglu…
yllysylseryllysylprolylseryllysylproly…
alanylleucylaspartylprolylisoleucylasp…
alylprolylleucylasparaginylisoleucylth…
hreonylleucyllysyltryptophylalanyllysy…
lglycylphenylalanyllysylisoleucylthreo…
yllysylarginylaspartylleucylprolylaspa…
llysylalanylasparaginylphenylalanylser…
lasparaginylglutamylphenylalanylthreon…
tamylaspartylalanylalanyltyrosylglutam…
alanyllysylasparaginylalanylalanylglyc…
erylglutamylprolylserylaspartylalanyli…
artylaspartylvalylglutamylalanylprolyl…
yllysylphenylalanyllysylaspartylthreon…
ycylglutamylalanylphenylalanylarginyll…
ylglycylarginylprolylprolylprolylthreo…
lysylaspartylglycyllysylglutamylleucyl…
ucylglutamylisoleucyllysylisoleucylala…
lasparaginylleucylvalylasparaginyllysy…
laspartylserylglycylalanyltyrosylthreo…
raginylprolylglycylglycylphenylalanyla…
anylasparaginylvalyllysylvalylleucylas…
ylglutamylglycylprolylleucylalanylvaly…
glutamyllysylcysteinylvalylleucylseryl…
eucylaspartylaspartylglycylglycylalany…
sylisoleucylvalylglutaminyllysylarginy…
alanyltryptophylthreonylasparaginylval…
lvalylthreonyllysylleucyllysylvalylthr…
paraginylglutamyltyrosylisoleucylpheny…
alylasparaginyllysyltyrosylglycylvalyl…
erylglutamylprolylvalylleucylalanylval…
lylprolylaspartylprolylprolyllysylaspa…
hreonylisoleucylthreonyllysylaspartyls…
ptophylglycylhistidylprolylaspartylser…
isoleucylisoleucylasparaginyltyrosylis…
spartyllysylalanylglycylglutaminylargi…
lasparaginyllysyllysylthreonylleucylth…
ysylvalylserylglycylleucylthreonylglut…
utamylphenylalanylarginylisoleucylmeth…
lalanylglycylisoleucylserylalanylproly…
ylalanyltyrosyllysylalanylcysteinylasp…
prolylglycylprolylprolylglycylasparagi…
threonylserylarginylserylserylisoleucy…
raginyllysylprolylisoleucyltyrosylaspa…
cylthreonylglycyltyrosylmethionylvalyl…
glutamylglutamylaspartylglutamyltrypto…
lprolylprolylalanylglycylleucyllysylal…
leucylthreonylglycylleucylthreonylglut…
rosyllysylisoleucylarginylisoleucyltyr…
glutamylglycylleucylglycylglutamylprol…
onylprolyllysylalanylglutamylaspartyla…
utamylisoleucylglutamylleucylaspartyla…
lvalylthreonylisoleucylarginylalanylcy…
ylleucylphenylalanylvalylprolylisoleuc…
rolylglutamylvalyllysyltryptophylalany…
mylserylleucylaspartyllysylalanylseryl…
ryltyrosylthreonylleucylleucylisoleucy…
inylarginylphenylalanylaspartylserylgl…
onylvalylglutamylasparaginylserylseryl…
anylvalylasparaginylvalylarginylvalyll…
olylprolylglutaminylaspartylleucyllysy…
ylthreonylserylvalylthreonylleucylthre…
eucylleucylaspartylglycylglycylserylly…
isoleucylvalylglutamyllysylarginylglut…
tyrosylserylthreonylvalylalanylthreony…
hreonylseryltryptophyllysylvalylaspart…
lglycylcysteinylseryltyrosyltyrosylphe…
utamylasparaginylglutamyltyrosylglycyl…
utamylthreonylalanylglutamylserylvalyl…
ylleucylprolylprolylglycyllysylisoleuc…
lylthreonylarginylasparaginylserylvaly…
lysylprolylglutamylhistidylaspartylgly…
lglycyltyrosylisoleucylvalylglutamylme…
lserylaspartyllysyltryptophylalanylthr…
sylvalylthreonylglutamylalanylthreonyl…
cylglutaminylglycylglutamylglutamyltyr…
rylalanylglutaminylasparaginylglutamyl…
olylarginylglutaminylleucylserylvalylp…
tylleucylvalylisoleucylprolylprolylala…
nylalanylasparaginylthreonylphenylalan…
utamylaspartylleucyllysylvalylaspartyl…
cylarginylprolylthreonylprolylalanylva…
spartylasparaginylvalylprolylleucyllys…
valylasparaginylalanylglutamylserylthr…
serylleucylleucylthreonylisoleucyllysy…
amylaspartylvalylglycylhistidyltyrosyl…
ginylserylalanylglycylglutamylalanylis…
ginylvalylisoleucylvalylleucylaspartyl…
ylglycylprolylvalyllysylmethionylaspar…
tylserylisoleucylthreonylleucylseryltr…
sylaspartylglycylglycylserylserylisole…
oleucylvalylglutamyllysylarginylaspart…
onyltryptophylglutaminylisoleucylvalyl…
ylthreonylthreonylisoleucyllysylalanyl…
glycylcysteinylglutamyltyrosylglutamin…
lalanylglutamylasparaginylarginyltyros…
ucylasparaginylserylglutamylprolylthre…
lylphenylalanyllysylvalylprolylglycylp…
lvalylthreonylleucylserylserylarginyla…
lutaminyltryptophylasparaginylglutamyl…
lycylserylarginylvalylisoleucylglycylt…
lysylglutamylarginylasparaginylserylis…
ucylasparaginyllysylthreonylprolylisol…
henylalanyllysylthreonylthreonylglycyl…
utamyltyrosylglutamylphenylalanylargin…
ylisoleucylvalylglycylisoleucylglycyll…
mylcysteinyltyrosylvalylalanylarginyla…
lprolylglycylarginylprolylglutamylalan…
ginylasparaginylserylvalylthreonylleuc…
lylthreonyltyrosylaspartylglycylglycyl…
rosylisoleucylvalylglutamyllysyllysylg…
ginyltryptophylmethionyllysylalanylser…
oleucylisoleucylaspartylthreonylhistid…
glycylleucylvalylglutamylaspartylhisti…
ylarginylvalylisoleucylalanylarginylas…
nylalanylserylglutamylprolylserylgluta…
ylthreonylalanylarginylaspartylglutamy…
oleucylserylmethionylaspartylprolyllys…
ucylvalylvalylhistidylalanylglycylglut…
rtylalanylaspartylisoleucyltyrosylglyc…
lisoleucylglutaminyltryptophylisoleucy…
mylleucylserylasparaginylthreonylalany…
lserylthreonylaspartylphenylalanylalan…
laspartylalanylvalylarginylvalylaspart…
eucylleucyllysylalanyllysylasparaginyl…
ylvalylthreonylvalylasparaginylvalylly…
glycylprolylprolylglutamylglycylprolyl…
threonylalanylglutamyllysylcysteinylth…
olylprolylleucylglutaminylaspartylglyc…
ucylasparaginyltyrosylisoleucylvalylgl…
lserylarginylleucylvalyltryptophylthre…
inylvalylglutaminylthreonylleucylseryl…
cylleucylglutamylglycylasparaginylglut…
nylisoleucylmethionylalanylvalylaspara…
lutamylprolylleucylglutamylserylglutam…
ginylprolylphenylalanylvalylvalylproly…
lylglutamylvalylthreonylthreonylvalylt…
soleucylvalylvalyltryptophylglutamylar…
lglycylserylglutamylisoleucylleucylgly…
rginylaspartyllysylglutamylglycylisole…
lcysteinylhistidyllysylarginylleucylis…
eucylarginylvalylthreonylglycylleucyli…
aspartyltyrosylglutamylphenylalanylarg…
inylalanylalanylglycylleucylserylgluta…
yltyrosylglutaminyllysylalanylcysteiny…
lprolylglycylprolylprolylasparaginylas…
spartylisoleucylthreonylarginylserylse…
tophylseryllysylprolylisoleucyltyrosyl…
ylisoleucylglutaminylglycyltyrosylisol…
artylvalylasparaginylvalylglycylglutam…
nylthreonylprolylprolylthreonylglycyli…
araginylisoleucylglutamylvalylglutamyl…
dylglutamyltyrosylasparaginylphenylala…
soleucylasparaginyllysylalanylglycylva…
rtylvalylprolylglycylprolylisoleucylis…
ucylglutamylalanylprolylaspartylisoleu…
amylleucylarginyllysylisoleucylisoleuc…
glycylglycylserylleucylarginylleucylph…
glycylarginylprolylthreonylprolylgluta…
alylaspartylglycylglutamylisoleucylarg…
oleucylaspartylvalylthreonylserylseryl…
lleucylaspartylasparaginylvalylasparag…
yllysyltyrosylthreonylleucylthreonylle…
ycylthreonyllysylserylalanylphenylalan…
cylaspartylthreonylprolylserylprolylpr…
lthreonylglutamylisoleucylthreonyllysy…
reonyltryptophylglutamylprolylprolylle…
lysylisoleucyllysylasparaginyltyrosyli…
utamylalanylthreonylarginyllysylserylt…
lasparaginylcysteinylhistidyllysylaspa…
laspartylglutaminylleucylglutaminylglu…
osylphenylalanylarginylvalylthreonylal…
sylglycylisoleucylglycylleucylprolylal…
lprolylisoleucyllysylvalylalanylglutam…
glycyllysylisoleucylthreonylvalylaspar…
raginylserylvalylserylleucylseryltrypt…
tidylaspartylglycylglycylseryllysyliso…
leucylvalylglutamylmethionylglutaminyl…
yltryptophylserylglutamylcysteinylalan…
minylalanylvalylisoleucylthreonylaspar…
lglutamylglutamyltyrosylleucylphenylal…
araginylglutamyllysylglycylarginylsery…
anylvalylprolylisoleucylvalylalanyllys…
mylprolylaspartylvalyllysylprolylalany…
valylglutaminylvalylglycylglutaminylas…
alylprolylisoleucylserylglycylarginylp…
reonyltryptophylthreonyllysylaspartylg…
nylthreonylthreonylarginylisoleucylasp…
eucylaspartylleucylthreonylthreonylleu…
nylhistidyllysylaspartylaspartylglycyl…
cylthreonylvalylalanylasparaginylvalyl…
lanylserylisoleucylglutamylisoleucylva…
laspartylprolylprolyllysylglycylprolyl…
tylvalylserylalanylglutamylserylisoleu…
araginylprolylprolylleucyltyrosylthreo…
soleucylthreonylasparaginyltyrosylisol…
artylthreonylthreonylthreonylthreonylv…
ylalanylthreonylvalylalanylarginylthre…
llysylleucyllysylthreonylglycylthreony…
nylarginylisoleucylphenylalanylalanylg…
cylglutaminylserylphenylalanylalanylle…
eucylvalylalanylglutaminyltyrosylproly…
olylprolylglycylthreonylprolylphenylal…
ryllysylaspartylserylmethionylvalyliso…
lutamylprolylvalylasparaginylasparagin…
ucylglycyltyrosylhistidylleucylglutamy…
inylserylisoleucylleucyltryptophylthre…
nylisoleucylisoleucylhistidylaspartylt…
lanylglutaminylasparaginylleucylglutam…
rosylglutamylphenylalanylarginylvalylt…
eucylvalylglycylvalylglycyllysylalanyl…
ysteinyltyrosylvalylalanylarginylaspar…
lylglycylthreonylprolylglutamylprolyli…
sparaginylglutamylisoleucylthreonylleu…
lprolylvalyltyrosylaspartylglycylglycy…
cyltyrosylisoleucylvalylglutamyllysyla…
lycylarginyltryptophylmethionyllysylal…
ginylvalylisoleucylglutamylthreonylglu…
ylglycylleucylthreonylglutamylaspartyl…
nylalanylarginylvalylisoleucylalanylly…
nylisoleucylseryllysylprolylserylaspar…
ylthreonylalanyllysylaspartylglutamylv…
eucylserylmethionylaspartylprolyllysyl…
isoleucylvalylvalylasparaginylalanylgl…
inylleucylglutamylalanylaspartylvalylh…
lthreonylisoleucylglutamyltryptophylle…
mylisoleucylglutamylglutamylserylalany…
ysylasparaginylthreonylaspartylphenyla…
ylvalyllysylaspartylalanylisoleucylarg…
utaminyltyrosylisoleucylleucylarginyla…
cylseryllysylserylphenylalanylprolylva…
aspartylarginylprolylglycylprolylproly…
lvalylthreonylglycylvalylthreonylseryl…
reonyltryptophylserylprolylprolylleucy…
laspartylisoleucylserylhistidyltyrosyl…
mylthreonylserylarginylleucylalanyltry…
lglutamylvalylvalylthreonylasparaginyl…
eucylleucylglutamylglycylasparaginylgl…
ylisoleucylmethionylalanylvalylasparag…
utamylprolylleucylglutamylserylalanylp…
aginylprolylphenylalanylvalylleucylpro…
ylglutamylvalylthreonylasparaginylisol…
nylthreonylvalylcysteinyltryptophylasp…
spartylglycylglycylserylglutamylisoleu…
alylglutamyllysylarginylaspartylarginy…
hylisoleucyllysylcysteinylasparaginyll…
aspartylleucylarginylleucylarginylvaly…
ylaspartylhistidylglutamyltyrosylgluta…
nylglutamylasparaginylalanylalanylglyc…
lylalanylthreonylvalyltyrosyltyrosylly…
ylphenylalanyllysylprolylglycylprolylp…
dylisoleucylvalylaspartylthreonylthreo…
reonylleucylalanyltryptophylglycyllysy…
ylglycylserylglutamylisoleucylleucylgl…
cylcysteinyllysylalanylaspartylglutamy…
ylisoleucylvalylthreonylprolylglutamin…
hreonylarginylphenylalanylglutamylisol…
ylhistidylglutaminylglutamyltyrosyllys…
nylleucylasparaginyllysylvalylglycylle…
ylvalylprolylglycylthreonylvalyllysylp…
tamylalanylprolylglutamylleucylasparty…
rginyllysylglycylisoleucylvalylvalylar…
rginylisoleucylhistidylisoleucylprolyl…
lmethionylprolylglutamylisoleucylthreo…
utamylglycylglutamylphenylalanylthreon…
ucylglutamyllysylglycylvalylasparaginy…
ylisoleucylaspartylasparaginylcysteiny…
alanylglycyllysyltyrosylisoleucylleucy…
lserylglycylseryllysylserylalanylpheny…
leucylaspartylthreonylprolylglycylprol…
alanylvalyllysylglutamylvalylarginylly…
eucylvalyltryptophylglutamylprolylprol…
lycylalanyllysylvalyllysylasparaginylt…
ginylglutamylserylthreonylarginyllysyl…
serylseryllysylcysteinylseryllysylthre…
amylasparaginylleucylthreonylglutamylg…
henylalanylarginylvalylmethionylalanyl…
anylglycylvalylglycylvalylprolylvalylg…
alyllysylalanylalanylglutamylprolylpro…
lthreonylleucylthreonylaspartylvalylse…
ylleucylmethionyltryptophylglutamyllys…
cylglycylserylarginylvalylleucylglycyl…
lutaminylprolyllysylglycylthreonylglut…
lylalanylglutamylseryllysylvalylcystei…
nylglycylleucylserylserylglycylglutami…
lanylarginylvalyllysylalanyltyrosylasp…
ylaspartylprolylarginylvalylleucylglyc…
sylaspartylleucylthreonylisoleucylglut…
rolylphenylalanylasparaginylthreonylty…
glycylglutamylaspartylleucyllysylisole…
leucylglycylarginylprolylarginylprolyl…
valyllysylaspartylglycylglutamylprolyl…
ylarginylvalylasparaginylvalylglutamyl…
threonylvalylleucylhistidylisoleucylly…
partylaspartylphenylalanylglycyllysylt…
reonylasparaginylserylalanylglycylthre…
ylleucylserylvalylisoleucylvalylleucyl…
ylvalylglycylprolylvalylarginylphenyla…
ylaspartylphenylalanylvalylvalylisoleu…
lylalanyltyrosylthreonylglycylglycylcy…
raginyltyrosylisoleucylvalylglutamylly…
hreonylthreonylthreonyltryptophylhisti…
lvalylalanylarginylthreonylthreonyliso…
ucyllysylthreonylglycylthreonylglutamy…
ylisoleucylphenylalanylalanylglutamyla…
serylalanylprolylleucylaspartylserylly…
nyltyrosylprolylphenylalanyllysylgluta…
reonylprolylphenylalanylvalylthreonyls…
aminylmethionylleucylvalylglutaminyltr…
asparaginylaspartylglycylglycylthreony…
ylhistidylleucylglutamylglutaminyllysy…
ucylleucyltryptophylvalyllysylleucylas…
ylglutaminylaspartylthreonyllysylpheny…
eucylaspartylglutamylglycylleucylgluta…
valylserylalanylglutamylasparaginyliso…
ylprolylseryllysylvalylserylglutamylcy…
ylaspartylprolylcysteinylaspartylproly…
lanylisoleucylvalylisoleucylthreonylar…
eonylleucyllysyltryptophyllysyllysylpr…
ylseryllysylisoleucylthreonylglycyltyr…
laspartylleucylprolylaspartylglycylarg…
erylphenylalanylthreonylasparaginylval…
nylalanylthreonylvalylserylglycylleucy…
inyltyrosylglutamylphenylalanylarginyl…
nylalanylalanylglycylasparaginylphenyl…
tylserylserylglycylalanylisoleucylthre…
oleucylaspartylalanylprolylasparaginyl…
ltyrosyllysylaspartylvalylisoleucylval…
threonylphenylalanylvalylleucylglutamy…
yllysylprolylisoleucylprolylaspartylva…
lglycyllysylglutamylleucylglutamylglut…
ionylglutamylisoleucyllysylserylthreon…
hreonylleucylvalylvalyllysylaspartylcy…
rtylglycylglycylglutaminyltyrosylisole…
ylvalylglycylglycylthreonyllysylseryli…
llysylvalylleucylaspartylarginylprolyl…
ylleucyllysylvalylthreonylglycylvalylt…
tyrosylleucylalanyltryptophylasparagin…
tylglycylglycylalanylasparaginylisoleu…
leucylglutamyllysylarginylglutamylthre…
ylthreonylglutaminylvalylserylthreonyl…
asparaginyltyrosyllysylvalylthreonylly…
nylglutamyltyrosylisoleucylphenylalany…
paraginyllysyltyrosylglycylisoleucylgl…
ylglycylprolylvalylthreonylalanylcyste…
olylprolylglycylprolylprolylserylthreo…
oleucylthreonyllysylaspartylserylmethi…
nylarginylprolylvalylaspartylaspartylg…
lglutamylglycyltyrosylisoleucylleucylg…
tamylglycylvalylarginyltryptophylthreo…
sylthreonylleucylthreonylaspartylleucy…
lycylleucylthreonylglutamylglycylhisti…
arginylvalylalanylalanylglutamylaspara…
lutamylprolylserylglutamylprolylserylv…
lcysteinylaspartylalanylleucyltyrosylp…
sparaginylprolyllysylvalylthreonylaspa…
alylserylleucylalanyltryptophylserylly…
ycylglycylalanylprolylvalyllysylglycyl…
glutamylalanylalanylalanylaspartylglut…
inylthreonylprolylprolylthreonylglycyl…
ylphenylalanylthreonylvalylthreonyllys…
eonylglutamyltyrosylasparaginylphenyla…
lisoleucylasparaginylserylglutamylglyc…
reonylleucylprolylglycylserylvalylvaly…
leucylglutamylprolylprolylglutamylisol…
partylleucylarginyllysylvalylvalylvaly…
onylleucylarginylleucylphenylalanylval…
ylprolylglutamylprolylglutamylvalyllys…
amylglycylisoleucylleucylthreonylaspar…
glutamylvalylthreonylserylserylphenyla…
oleucylaspartylasparaginylvalylthreony…
ycylarginyltyrosylasparaginylleucylthr…
aginylserylglycylseryllysylthreonylala…
larginylvalylleucylaspartylserylprolyl…
ucylthreonylisoleucylarginylglutamylva…
onylleucylseryltryptophylglutamylproly…
lglycylalanyllysylisoleucylthreonylasp…
yllysylarginylglutamylthreonylthreonyl…
onylisoleucylthreonylasparaginylaspara…
threonylphenylalanylarginylisoleucylgl…
utamylglycylcysteinylseryltyrosyltyros…
nylserylasparaginylglutamyltyrosylglyc…
glutamylthreonylthreonylglutamylprolyl…
rolylleucylprolylprolylglycylarginylva…
threonylarginylasparaginylthreonylalan…
lutamyllysylprolylglutamylserylasparty…
eonylglycyltyrosylvalylvalylglutamylme…
lserylglutamyllysyltryptophylserylthre…
llysylthreonylleucylglutamylalanylthre…
nylalanylglycylglutamylglutamyltyrosyl…
alanylvalylasparaginylglutamyllysylgly…
lglutaminylleucylglycylvalylprolylvaly…
eucylglutamylisoleucyllysylprolylseryl…
ylhistidylthreonylphenylalanylasparagi…
lutaminylleucyllysylisoleucylaspartylv…
ginylprolylglutaminylalanylthreonylval…
aspartylglycylglutaminylthreonylleucyl…
lvalylasparaginylvalylserylserylseryll…
lserylisoleucyllysylglutamylalanylsery…
reonyltyrosylglutamylleucylcysteinylva…
lserylisoleucylthreonylvalylprolylisol…
lleucylaspartylarginylprolylglycylprol…
lisoleucylaspartylglutamylvalylserylcy…
ylisoleucylseryltryptophylasparaginylp…
lycylglycylcysteinylglutaminylisoleucy…
lylglutamyllysyllysylglutamylthreonylt…
hylhistidylisoleucylvalylserylglutamin…
erylisoleucyllysylisoleucylvalylarginy…
lutamyltyrosylglutaminylphenylalanylar…
paraginylarginyltyrosylglycyllysylsery…
lalanylvalylvalylalanylglutamyltyrosyl…
glycylprolylprolylglycylthreonylprolyl…
yllysylserylthreonylmethionylleucylval…
prolylvalylasparaginylaspartylglycylgl…
ltyrosylhistidylleucylglutamyltyrosyll…
cylleucyltryptophylseryllysylalanylasp…
ylalanylaspartylthreonylglutaminylvaly…
lglutamylglycylleucylmethionyltyrosylg…
anylglutamylasparaginylisoleucylalanyl…
seryllysylserylcysteinylglutamylprolyl…
lylcysteinylaspartylprolylprolylglycyl…
ylasparaginylisoleucylthreonylarginyll…
ophylseryllysylprolylhistidyltyrosylas…
cylthreonylglycyltyrosylisoleucylvalyl…
lprolylaspartylglycylarginyltryptophyl…
sylthreonylasparaginylisoleucylglutami…
nylglutamylvalylthreonylglutamylleucyl…
rginyltyrosylglutamylphenylalanylargin…
araginylalanylalanylaspartylserylvalyl…
ylthreonylglycylprolylisoleucylisoleuc…
utamylprolylprolylarginylvalylmethiony…
lanylarginylaspartylvalylisoleucylvaly…
lleucyllysylisoleucylasparaginylalanyl…
lprolylleucylprolylvalylisoleucylseryl…
isoleucylglutamylisoleucylglutamylglut…
tamylisoleucylisoleucylserylthreonylas…
ucylleucylthreonylvalyllysylaspartylcy…
tylthreonylglycylglutaminyltyrosylvaly…
ylvalylalanylglycylthreonylarginylsery…
yllysylvalylleucylaspartyllysylprolylg…
leucylglutamylisoleucylasparaginylglyc…
cysteinylserylleucylseryltryptophylgly…
spartylglycylglycylalanylaspartylisole…
rginyllysyllysylarginylglutamylthreony…
lthreonylisoleucylcysteinylglutamylgly…
lthreonylserylcysteinyllysylvalylthreo…
raginylglutamyltyrosylisoleucylphenyla…
lasparaginyllysyltyrosylglycylvalylgly…
lvalylalanylisoleucyllysylalanylleucyl…
alylprolylserylprolylprolylthreonylser…
rylvalylthreonyllysylglutamylserylmeth…
hylserylarginylprolylglutamylserylaspa…
cylserylglycyltyrosylisoleucylisoleucy…
lasparaginylserylleucylarginyltryptoph…
lysylprolylvalyltyrosylaspartylleucyla…
leucylarginylglutamylglycylcysteinylgl…
valyltyrosylalanylglutamylasparaginyla…
rolylserylglutamylthreonylserylprolyll…
aspartylprolylvalylphenylalanylleucylp…
lyllysylisoleucylvalylaspartylserylgly…
reonylisoleucylalanyltryptophylvalylly…
glycylglycylalanylprolylisoleucylthreo…
yltyrosyllysyllysylserylaspartylaspart…
reonylserylisoleucylglutaminylserylleu…
osylthreonylisoleucylserylglycylleucyl…
ltyrosylvalylphenylalanylarginylvalyll…
glycylalanylserylaspartylprolylserylas…
minylisoleucylalanyllysylglutamylargin…
cylphenylalanylaspartylisoleucylaspart…
lthreonylleucylisoleucylvalyllysylalan…
onylmethionylthreonylvalylprolylphenyl…
ylprolylasparaginylvalylleucyltryptoph…
spartylleucylarginylthreonylarginylala…
onylaspartylserylarginylthreonylseryll…
aginylalanylasparaginylarginylasparagi…
hreonylleucylthreonylisoleucylglutamin…
alanylserylleucylthreonylleucylvalylva…
prolylglycylprolylprolylthreonylaspara…
ylaspartylvalylthreonyllysylglutamylse…
aspartylvalylprolylglutamylasparaginyl…
yllysylasparaginyltyrosylhistidylisole…
nylseryllysyllysylalanyltryptophylvaly…
aginylcysteinylasparaginylarginylleucy…
raginylleucylglutaminylglutamylglycyla…
lanylarginylvalylserylglycylglutamylas…
valylglycylisoleucylprolylalanylglutam…
ysylisoleucylthreonylglutamyllysylprol…
cylglycylvalylthreonylserylisoleucylse…
ylthreonyltryptophylleucyllysylprolylg…
serylarginylisoleucylvalylhistidyltyro…
utamyllysylglycylglutaminyllysylaspara…
lanylvalylalanyllysylserylthreonylhist…
ucylarginylglutamylasparaginylserylglu…
larginylvalylphenylalanylalanylglutamy…
eucylserylaspartylprolylarginylglutamy…
lisoleucyllysylglutamylglutaminylleucy…
cylaspartylmethionyllysylasparaginylph…
ylvalyltyrosylvalylarginylalanylglycyl…
artylisoleucylprolylisoleucylserylglyc…
threonylleucylserylarginylaspartylglyc…
nylmethionylarginylphenylalanylasparag…
ylalanylglutamylasparaginylleucylthreo…
lutamylserylvalylthreonylalanylasparty…
isoleucylthreonylalanylalanylasparagin…
ysylalanylphenylalanylisoleucylasparag…
ylarginylprolylglycylprolylprolylthreo…
erylaspartylisoleucylthreonylglutamylg…
ltryptophylglutamylprolylprolyllysylty…
minylvalylthreonylasparaginyltyrosylis…
amylthreonylserylthreonylalanylvalyltr…
lanylthreonylvalylalanylarginylthreony…
nyllysylleucylthreonylthreonylglycylgl…
ylalanylarginylisoleucyllysylalanylglu…
glycylisoleucylserylaspartylhistidylis…
valylthreonylvalyllysylleucylprolyltyr…
lylprolylserylthreonylprolyltryptophyl…
ylarginylglutamylserylisoleucylthreony…
mylprolylvalylserylasparaginylglycylgl…
sylhistidylleucylglutamylmethionyllysy…
leucylleucyltryptophylglutaminyllysyla…
leucylarginylthreonylthreonylhistidylp…
ylisoleucylserylalanylglycylleucylisol…
inylvalyltyrosylalanylglutamylasparagi…
ylprolylserylhistidylprolylserylglutam…
spartylalanylcysteinylglutamylprolylpr…
soleucylthreonylaspartylisoleucylseryl…
ylseryltryptophylglutaminylglutaminylp…
ylglycylseryllysylisoleucylthreonylgly…
inylarginylaspartylleucylprolylasparty…
ylalanylserylphenylalanylthreonylaspar…
glutaminylphenylalanylthreonylisoleucy…
lasparaginylserylglutaminyltyrosylglut…
lanylalanylarginylasparaginylalanylval…
nylprolylserylglutamylvalylvalylglycyl…
leucylaspartylseryltyrosylglycylglycyl…
rolylleucylglutamyltyrosylthreonylglut…
anylglycylthreonylserylvalyllysylleucy…
lycyllysylprolylalanylprolylthreonylis…
ylaspartylaspartyllysylglutamylleucylg…
eucylvalylcysteinylvalylglutamylaspara…
alanylserylisoleucylleucylisoleucyllys…
ylasparaginylserylglycylcysteinyltyros…
sparaginylalanylmethionylalanylserylal…
inylvalylglutaminylisoleucylleucylaspa…
ycylglycylprolylisoleucylglutamylpheny…
anylglutamyllysylisoleucylthreonylleuc…
ylalanylaspartylaspartylglycylglycylal…
yrosylisoleucylvalylglutamyllysylargin…
valyltryptophylserylmethionylvalylsery…
amylcysteinylisoleucylisoleucylthreony…
eucyllysylglycylasparaginylglutamyltyr…
ylarginylalanylvalylasparaginyllysylty…
rolylleucylglutamylserylaspartylserylv…
ylphenylalanylvalylthreonylprolylglycy…
lutamylvalylthreonyllysylisoleucylthre…
hreonylvalylvalyltryptophylserylarginy…
lglycylserylaspartylisoleucylserylglyc…
lysylarginylaspartyllysyllysylserylleu…
lvalylleucyllysylglutamylthreonylisole…
lutaminyllysylvalylthreonylglycylleucy…
partyltyrosylglutaminyltyrosylarginylv…
alanylalanylglycylglutaminylglycylprol…
rylglutamylphenylalanyltyrosyllysylala…
artylprolylprolylglycylprolylprolylala…
anylaspartylserylthreonyllysylserylser…
tophylseryllysylprolylvalyltyrosylaspa…
eonylglycyltyrosylvalylvalylglutamylis…
mylglutamylglutamylglutamyltryptophylt…
sylglycylglutamylvalylarginylthreonylt…
ylasparaginylleucyllysylprolylglycylva…
lanylarginylvalylserylalanylvalylaspar…
ylglycylglutamylprolylisoleucylglutamy…
valylglutaminylalanyllysylaspartylisol…
amylisoleucylaspartylleucylaspartylval…
alylisoleucylalanyllysylalanylglycylgl…
eucylisoleucylprolylphenylalanyllysylg…
nylvalylthreonyltryptophylarginyllysyl…
cylglycylserylaspartylalanylarginyltyr…
ylthreonylaspartylserylserylserylleucy…
minylvalylthreonylarginylasparaginylas…
leucylleucylthreonylisoleucylglutamyla…
prolyllysylserylserylthreonylvalylsery…
nylprolylalanylalanylcysteinylglutamin…
stidylvalylserylarginylglycylthreonylv…
spartylprolylprolylleucylisoleucylaspa…
lisoleucylasparaginyltyrosylvalylisole…
nylthreonyllysylarginylthreonyltryptop…
lcysteinylserylserylthreonylserylpheny…
leucylserylglutamyllysylthreonylprolyl…
larginylvalylleucylalanylglutamylaspar…
cylglycylglutamylprolylcysteinylglutam…
yllysylalanylalanylglutamylvalylprolyl…
lleucylserylmethionyllysylaspartylsery…
leucylleucylseryltryptophylthreonyllys…
lglycylglycylserylvalylisoleucylthreon…
arginyllysylglycyllysylglycylglutamylg…
tidylalanylglycylisoleucylseryllysylth…
tamylvalylserylglutaminylleucyllysylgl…
tamylphenylalanylarginylvalylphenylala…
sylglycylleucylserylaspartylprolylvaly…
ucylthreonylvalyllysylglutamylleucylis…
mylvalylaspartylleucylserylaspartyliso…
alylthreonylvalylarginylisoleucylglycy…
ucylglutamylleucylprolyltyrosyllysylgl…
eucylseryltryptophylleucyllysylasparty…
mylserylglutamylphenylalanylvalylargin…
tamylasparaginyllysylisoleucylthreonyl…
lalanyllysyllysylglutamylhistidylglycy…
leucylleucylaspartylasparaginylalanylv…
valylprolylisoleucylthreonylvalylisole…
lseryllysylprolyllysylglycylprolylisol…
tamylisoleucyllysylalanylaspartylseryl…
aspartylvalylprolylglutamylaspartylasp…
soleucylthreonylcysteinyltyrosylseryli…
lthreonylserylglutaminylthreonylaspara…
ysteinylserylserylvalylalanylarginylth…
lprolylasparaginylleucylvalyllysylaspa…
phenylalanylarginylvalylarginylalanylg…
cylvalylserylglutaminylprolylleucylval…
alanyllysylhistidylglutaminylphenylala…
ylprolylglycyllysylprolylvalylisoleucy…
ylaspartylglycylmethionylserylleucylth…
lvalyltyrosylaspartylglycylglycylseryl…
anylhistidylvalylglutamyllysyllysylglu…
ylleucyltryptophylglutaminyllysylvalyl…
ucylserylglycylarginylglutamyltyrosyla…
ylglutamylglycylleucylaspartyltyrosylg…
rosylalanylglutamylasparaginylserylala…
laspartylprolylseryllysylphenylalanylt…
valylaspartylprolylprolylglycylthreony…
rtylvalylthreonylarginylglutamylthreon…
ophylasparaginylprolylprolylleucylargi…
oleucylvalylglycyltyrosylserylisoleucy…
ylasparaginylglutamylarginyltryptophyl…
nylalanylthreonylaspartylvalylserylglu…
onylvalylthreonylglycylleucylserylprol…
mylphenylalanylarginylisoleucylisoleuc…
ylglycylthreonylisoleucylserylprolylpr…
isoleucylisoleucylmethionylthreonylarg…
lprolylprolylisoleucylvalylglutamylphe…
lphenylalanylaspartylglycylleucylisole…
ylserylleucylarginylisoleucyllysylalan…
lprolylvalylprolylarginylvalylthreonyl…
glycylvalylglutamylisoleucylglutamylly…
onylglutamylisoleucylthreonylasparagin…
ylleucylphenylalanylvalylarginylaspart…
idylarginylglycylvalyltyrosylthreonylv…
lanylserylglycylserylalanyllysylalanyl…
ylglutaminylaspartylthreonylprolylglyc…
cylarginylphenylalanylthreonylasparagi…
ysylmethionylthreonylleucyltryptophylt…
asparaginylaspartylglycylcysteinylalan…
rosylisoleucylisoleucylglutamyllysylar…
ucylalanyltryptophylalanylleucylisoleu…
utamylalanylglutaminylseryltyrosylthre…
ucylasparaginylglycylasparaginylglutam…
nylvalylserylalanylvalylasparaginyllys…
nylprolylleucylaspartylserylaspartylpr…
ucylglutaminyltyrosylthreonylvalylprol…
ylprolylglutamylprolylserylasparaginyl…
erylisoleucylthreonylleucylthreonyltry…
erylaspartylglycylglycylserylglutamyli…
isoleucylleucylglutamylarginylarginylg…
yltryptophylvalyllysylvalylisoleucylse…
glutamylthreonylarginylphenylalanyllys…
glutamylglycylasparaginylglutamyltyros…
methionylalanylglutamylasparaginylalan…
ylserylglycylisoleucylserylarginylleuc…
tamylprolylvalylasparaginylprolylproly…
yllysylvalylthreonylaspartylthreonylse…
eucylglutamyltryptophylseryllysylproly…
cylmethionylglutamylisoleucylisoleucyl…
amylmethionylcysteinyllysylthreonylasp…
histidyllysylvalylasparaginylalanylglu…
nylarginyltyrosylthreonylvalylthreonyl…
lglutamylglutamyltyrosyllysylphenylala…
asparaginylglycylalanylglycyllysylglyc…
ylthreonylglycylthreonylisoleucyllysyl…
eonylalanylprolylglutamylleucylasparty…
phenylalanyllysylglutaminylthreonylhis…
lanylserylisoleucylarginylleucylphenyl…
nylglycylarginylprolylthreonylprolylth…
ylprolylaspartylserylasparaginylleucyl…
leucylhistidylthreonylthreonylaspartyl…
lthreonylvalylglutamylasparaginylcyste…
partylalanylglycyllysyltyrosylthreonyl…
nylasparaginylserylglycylseryllysylser…
onylvalyllysylvalylleucylaspartylthreo…
olylisoleucylthreonylphenylalanyllysyl…
erylalanylthreonylleucylmethionyltrypt…
ylaspartylglycylglycylalanylarginyliso…
alylglutamyllysylarginylglutamylalanyl…
lutaminylvalylisoleucylserylglutamylly…
ylisoleucylphenylalanyllysylvalylaspar…
lycylvalylprolyltyrosyltyrosylphenylal…
araginylglutamyltyrosylglycylvalylglyc…
ionylprolylglutamylprolylisoleucylvaly…
olylalanylprolylprolylarginylarginylle…
nylseryllysylserylserylalanylvalylleuc…
aspartylhistidylaspartylglycylglycylse…
rosylleucylleucylglutamylmethionylargi…
ylleucyltryptophylvalylglutamylalanylg…
lleucylthreonylphenylalanylthreonylval…
llysylthreonylglutamyltyrosylglutamylp…
ysylasparaginylaspartylalanylglycyltyr…
mylalanylphenylalanylserylserylvalylis…
glutaminylisoleucylglutamylprolylthreo…
ylisoleucylthreonylasparaginylglutamin…
ysylalanylglycylserylprolylphenylalany…
ylisoleucylserylglycylarginylprolylala…
yllysylleucylglutamylglutamylmethionyl…
spartylarginylvalylserylisoleucylthreo…
inylthreonylthreonylleucylthreonylvaly…
glycylaspartylserylglycylarginyltyrosy…
utamylasparaginylthreonylalanylglycylv…
alylthreonylvalylvalylvalylisoleucylgl…
hreonylglycylprolylisoleucylglutamylva…
ylserylcysteinylvalylleucylseryltrypto…
ylglycylglycylglycylthreonylglutamylis…
oleucylvalylglutamyllysylarginylglutam…
tryptophylglutaminylleucylvalylasparag…
onylglutaminylisoleucyllysylvalylthreo…
ylmethionylglutamyltyrosylserylphenyla…
asparaginylarginylphenylalanylglycylva…
rylalanylprolylisoleucylisoleucylalany…
valylprolylprolylserylalanylprolylthre…
ylhistidylvalylserylalanylasparaginyla…
tryptophylglutamylglutamylprolyltyrosy…
ysylisoleucylisoleucylglycyltyrosyltry…
mylarginylasparaginylthreonylisoleucyl…
sparaginyllysylvalylprolylcysteinylleu…
syllysylvalylthreonylglycylleucylvalyl…
glutaminylphenylalanylarginylthreonylt…
alanylglycylvalylseryllysylalanylseryl…
leucylmethionylalanylglutaminylasparag…
glycylarginylprolylglutamylvalylthreon…
threonylvalylserylleucylisoleucyltrypt…
aspartylglycylglycylseryllysylvalylval…
utamylarginyllysylprolylvalylserylglut…
ltryptophylleucyllysylcysteinylasparag…
rylaspartylasparaginylphenylalanylphen…
leucylserylglutamylglycylaspartylthreo…
ylvalylleucylalanyllysylasparaginylala…
ysylglycylserylglutamylserylthreonylgl…
inylaspartylglutamyltyrosylalanylproly…
artylalanylarginylleucylhistidylglycyl…
larginylalanylglycylserylaspartylleucy…
ylglycylglycyllysylprolylglutamylproly…
hreonyllysylglycylaspartyllysylglutamy…
myllysylvalylserylleucylglutaminyltyro…
threonylalanylvalylisoleucyllysylpheny…
laspartylserylglycyllysyltyrosylthreon…
ylalanylserylglycylthreonyllysylalanyl…
alylleucylaspartylserylprolylglycylpro…
ylvalylserylarginylvalylthreonylglutam…
eucylalanyltryptophylserylleucylprolyl…
cylalanylglutamylisoleucylthreonylhist…
ginylarginylglutamylthreonylserylargin…
soleucylvalylglutamylglycylglutamylcys…
sylvalylvalylthreonylarginylleucylisol…
tamyltyrosylisoleucylphenylalanylargin…
llysyltyrosylglycylprolylglycylvalylpr…
lisoleucylvalylalanylarginylasparaginy…
prolylserylprolylprolylglycylisoleucyl…
reonylglycyllysylglutamylhistidylisole…
ptophylthreonyllysylprolylglutamylsery…
tamylisoleucylserylasparaginyltyrosyll…
myllysylglutamylserylleucylarginyltryp…
yllysylaspartyltyrosylvalylvalyltyrosy…
valylthreonylserylleucylmethionylgluta…
utaminylphenylalanylarginylvalylthreon…
lglycylasparaginylserylglutamylprolyls…
phenylalanylisoleucylserylcysteinylarg…
nylprolylglycylprolylprolylserylalanyl…
onylthreonyllysylhistidylserylisoleucy…
llysylprolylmethionyltyrosylaspartylgl…
valylglycyltyrosylvalylleucylglutamylm…
rtylthreonylaspartylglutaminyltryptoph…
ylasparaginylalanylthreonylisoleucylar…
nylalanylthreonylvalylprolylaspartylle…
ysyltyrosylserylphenylalanylarginylval…
lysylglycylmethionylserylglutamyltyros…
glutamylisoleucylglutamylprolylvalylgl…
ucylprolylaspartylleucylglutamylleucyl…
sylthreonylvalylthreonylisoleucylargin…
nylleucylmethionylvalylserylvalylseryl…
lisoleucylthreonyltryptophylseryllysyl…
ucylalanylserylarginylalanylisoleucyli…
tamylseryltyrosylserylleucylleucylisol…
inylarginyltyrosylaspartylalanylglycyl…
ylalanylglutamylasparaginylglutaminyls…
onylvalylleucylvalyllysylvalyltyrosyla…
steinylprolylserylvalyllysylvalyllysyl…
rylvalylthreonylisoleucylthreonyltrypt…
lisoleucylaspartylglycylglycylalanylpr…
tyrosylisoleucylvalylglutamyllysylargi…
inylalanylphenylalanyllysylthreonylval…
yllysylthreonylleucyltyrosylarginyliso…
lglycylthreonylmethionylhistidyltyrosy…
ylglutamylasparaginylisoleucyltyrosylg…
ysteinylglutamylthreonylserylaspartyla…
alylprolylleucylvalylprolylalanyllysyl…
ylthreonyllysylserylthreonylvalylthreo…
sylprolylleucyltyrosylaspartylglycylgl…
ltyrosylvalylleucylglutamylalanylcyste…
ylarginyltryptophylmethionyllysylvalyl…
nylvalylleucylglutamylhistidylthreonyl…
glutamylglycylglutamylglutaminyltyrosy…
arginylalanylglutaminylasparaginylglut…
olylarginylglutamylthreonylvalylthreon…
laspartylleucylarginylvalylleucylproly…
ylthreonylmethionylprolylglutaminyllys…
lylalanylglycylarginylprolylvalylgluta…
cylalanylglycylarginylprolylprolylprol…
alanylphenylalanylalanylglycylseryllys…
larginylvalylthreonylvalylglutamylthre…
llysylleucylthreonylisoleucylarginylgl…
nylaspartylthreonylglycylglutamyltyros…
asparaginylvalylthreonylglycylthreonyl…
cyllysylvalylisoleucylisoleucylleucyla…
lthreonylglycylprolylisoleucyllysyliso…
rtylalanylthreonylserylisoleucylthreon…
rolylprolylglutamylleucylaspartylglycy…
ltyrosylvalylvalylglutamylglutaminylar…
rolylglycyltryptophylleucylprolylvalyl…
nylserylthreonylphenylalanyllysylpheny…
lglutamylglycylasparaginylglutamyltyro…
nylalanylthreonylasparaginylarginylphe…
tyrosylleucylglutaminylserylglutamylva…
lserylserylisoleucylarginylisoleucylpr…
nylleucylglutaminylisoleucylphenylalan…
glycylmethionylthreonylleucylthreonylt…
laspartylaspartylglycylglycylserylglut…
leucylvalylglutamylarginyllysylglutamy…
ryptophylvalylarginylvalylasparaginyll…
ylthreonylarginyltyrosylarginylserylth…
lycylleucylglutamyltyrosylglutamylhist…
ucylasparaginylalanylarginylglycylsery…
lseryllysylprolylisoleucylvalylalanylm…
ylprolylprolylglycyllysylprolylglutami…
eonylaspartylthreonylthreonylarginylth…
yptophylserylvalylprolylglutamylaspart…
ylthreonylglycyltyrosylleucylisoleucyl…
ylaspartylglutaminylhistidylglutamyltr…
aginylthreonylthreonylprolylthreonylly…
hreonylleucylthreonylhistidylleucylpro…
rosylarginylphenylalanylarginylvalylle…
lglycylglycylprolylglycylglutamylproly…
eonylvalyllysylvalylthreonylglutamylme…
spartyltyrosylglutamylleucylaspartylgl…
mylglycylisoleucylphenylalanylvalylarg…
eucylarginylleucylthreonylisoleucylpro…
henylalanylprolylisoleucylcysteinyllys…
ycylglutaminylaspartylisoleucylserylly…
lanylthreonylserylglutamylthreonylhist…
eucyllysylglutamylalanylaspartylarginy…
yrosylaspartylleucylvalylleucylglutamy…
yllysylalanylvalyltyrosylisoleucyllysy…
rylprolylasparaginylserylprolylglutamy…
spartylaspartylisoleucylglutaminylvaly…
tryptophylarginylprolylprolylalanylasp…
rtylisoleucylleucylglycyltyrosylisoleu…
amylvalylprolyllysylalanylalanyltrypto…
lserylarginylvalylarginylglycylthreony…
ucyllysylglutamylasparaginylvalylgluta…
ylvalylserylalanylglutamylasparaginylg…
lseryllysylprolylleucyllysylserylgluta…
llysylthreonylprolylleucylasparaginylp…
lasparaginylprolylprolylglutamylvalyll…
lserylvalylserylleucylseryltryptophyls…
tylglycylglycylserylarginylvalylthreon…
amylarginyllysylglutamylthreonylserylt…
ylhistidylasparaginyllysylthreonylglut…
onylmethionyltyrosylthreonylvalylthreo…
lanylglutamyltyrosylglutaminylphenylal…
glutaminylasparaginylaspartylvalylglyc…
rolylalanylserylglutamylprolylvalylval…
lalanylaspartyllysylprolylserylglutami…
ylisoleucylleucylserylisoleucylserylly…
glutaminyltryptophylglutamyllysylproly…
cyllysylglutamylisoleucylleucylglycylt…
larginylglutaminylserylglycylaspartyls…
asparaginyllysylglutamylarginylisoleuc…
lalanylthreonylisoleucylglycylglycylle…
tamyltyrosylglutamylphenylalanylarginy…
araginylglutamylthreonylglycylleucylse…
nylalanylmethionylserylisoleucyllysylt…
ylglutamylalanylprolylglycylisoleucyla…
partylvalylthreonylthreonyllysylleucyl…
lleucylserylcysteinylglutaminylisoleuc…
lylaspartylisoleucyllysyltryptophyltyr…
lutamylleucylisoleucylglutaminylseryla…
ylserylaspartylglycylarginylthreonylhi…
thionylthreonylglutamylglutamylglutami…
lyltyrosylthreonylcysteinylisoleucylal…
lglycylglutamylvalylglutamylthreonylse…
aminylalanylthreonylprolylglutaminylph…
ylprolylleucyllysylglutamyllysyltyrosy…
lthreonylleucylarginylleucylhistidylva…
rginylprolylvalylprolylalanylmethionyl…
dylglycylglutaminyllysylleucylleucylgl…
araginylisoleucylthreonylisoleucylglut…
idyltyrosylthreonylhistidylleucylvalyl…
minylarginyllysylthreonylhistidylalany…
inylleucylserylasparaginylvalylphenyla…
nylisoleucylleucylaspartylvalylglutamy…
olylaspartyllysylprolylthreonylglycylp…
lalanylleucylleucyllysylasparaginylser…
yllysylprolylprolylalanylaspartylaspar…
ucylthreonylasparaginyltyrosylvalylval…
nyllysylglutamylglycylalanylglutamyltr…
erylalanylisoleucylserylvalylthreonylt…
ylasparaginylleucylthreonylglutamylasp…
henylalanylarginylvalylserylalanylglut…
ylglycylisoleucylserylaspartylprolylle…
ylisoleucylisoleucyllysylserylprolylph…
alanylprolylglycyllysylprolylthreonyli…
lysylaspartylserylcysteinylvalylvalyla…
nylserylaspartylglycylglycylalanyllysy…
tyrosylleucylglutamyllysylarginylgluta…
ysyltryptophylisoleucylserylvalylthreo…
larginylglutamylthreonylvalylphenylala…
isoleucylglutamylglycylleucylglutamylt…
lyllysylcysteinylglutamylasparaginylle…
yltryptophylserylglutamylisoleucylsery…
lyllysylserylaspartylvalylprolylisoleu…
enylalanyllysylglutamylglutamylleucyla…
alylarginyltyrosylglutaminylserylaspar…
einyllysylvalylthreonylglycylhistidylp…
tryptophyltyrosylarginylglutaminylglyc…
anylaspartylglycylleucyllysyltyrosylar…
nylalanyllysylglycylglycyltyrosylhisti…
ylalanylserylvalylthreonylaspartylaspa…
sylglutaminylvalylarginylalanylthreony…
erylvalylserylglycylthreonylalanylsery…
olylalanyllysylisoleucylhistidylleucyl…
ycylmethionylglycylalanylvalylhistidyl…
lylvalylserylisoleucyllysylisoleucylpr…
lylaspartylprolylvalylisoleucylthreony…
taminylaspartylleucylisoleucylaspartyl…
ltyrosylglutaminylvalylisoleucylvalylt…
onylserylleucylvalylphenylalanylprolyl…
yllysylaspartylalanylglycylphenylalany…
sylasparaginylarginylphenylalanylglycy…
reonylvalylglutamylleucylaspartylvalyl…
olylprolylarginylglycylvalyllysylvalyl…
rtylserylvalylasparaginylleucylthreony…
anylserylaspartylglycylglycylseryllysy…
lisoleucylvalylglutamyllysylcysteinyla…
arginyltryptophylleucylarginylvalylgly…
hreonylarginyltyrosylthreonylvalylisol…
lycyllysylthreonylseryltyrosylglutamin…
alanylglutamylasparaginyllysylphenylal…
ylglutamylprolylserylglutamylprolylthr…
aspartyllysylthreonylarginylalanylmeth…
amylglutamylvalylaspartylglutamylthreo…
ylthreonyllysylalanylserylhistidylsery…
rosylglutamyllysyltyrosylmethionylisol…
ycylarginylglycylglutamylphenylalanylg…
ysteinylvalylglutamylthreonylserylsery…
alanyllysylphenylalanylvalyllysylvalyl…
ylvalylleucylvalyllysyllysylglutamylis…
nylisoleucylalanylarginylhistidylargin…
lleucylhistidylglutamylserylphenylalan…
tamylleucylvalylmethionylisoleucylphen…
ylserylglycylleucylaspartylisoleucylph…
sparaginylthreonylserylalanylphenylala…
larginylglutamylisoleucylvalylseryltyr…
teinylglutamylalanylleucylglutaminylph…
ylasparaginylisoleucylglycylhistidylph…
rolylglutamylasparaginylisoleucylisole…
larginylserylserylthreonylisoleucyllys…
lanylglycylglutaminylalanylarginylglut…
ylasparaginylphenylalanylarginylleucyl…
lylglutamyltyrosyltyrosylalanylprolylg…
dylaspartylvalylvalylserylthreonylalan…
ylserylleucylglycylthreonylleucylvalyl…
isoleucylasparaginylprolylphenylalanyl…
inylglutaminylglutaminylisoleucylisole…
hionylasparaginylalanylglutamyltyrosyl…
lglutamylalanylphenylalanyllysylglutam…
anylmethionylaspartylphenylalanylvalyl…
ylglutamylarginyllysylserylarginylmeth…
nylleucylglutaminylhistidylprolyltrypt…
eucylglutamylarginylvalylserylthreonyl…
eucyllysylhistidylarginylarginyltyrosy…
ucyllysyllysylaspartylleucylasparaginy…
ylarginylisoleucylserylcysteinylglycyl…
utaminyllysylglycylvalylserylvalylalan…
oleucylglutamylisoleucylglycylprolylva…
thionylhistidylalanylvalylglycylglutam…
lysyltyrosylvalylcysteinyllysylisoleuc…
lglutaminylserylthreonylglutaminylvaly…
nylglycylvalylarginylglutaminylleucylg…
ltyrosylglutamylisoleucylthreonyltyros…
isoleucylleucyltyrosylvalyllysylaspart…
tylaspartylglycylthreonyltyrosylarginy…
laspartyltyrosylglycylglutamylaspartyl…
ylphenylalanylvalyllysylglycylvalylarg…
osyltyrosylcysteinylarginylarginylthre…
ylarginylarginylthreonylaspartylthreon…
mylarginylprolylprolylglutamylphenylal…
ylasparaginyllysylthreonylalanyltyrosy…
larginylphenylalanylglycylvalylthreony…
ylglutamylprolylhistidylvalylthreonylt…
taminyllysylisoleucyllysylprolylglycyl…
yltyrosylthreonylphenylalanylglutamyls…
lglutaminylleucylthreonylisoleucylaspa…
partylaspartylaspartylalanylglutamylty…
lasparaginyllysyltyrosylglycylglutamyl…
sylleucylthreonylvalylthreonylleucylhi…
artylserylthreonylleucylarginylprolylm…
cylleucylalanylasparaginylalanylglutam…
glutaminylserylvalylcysteinylphenylala…
ylglycylisoleucylprolylprolylprolylthr…
ysylaspartylglycylglutaminylprolylleuc…
lisoleucylglutamylisoleucylisoleucylhi…
yrosyltyrosylalanylleucylhistidylisole…
olylglutamylaspartylthreonylglycyltyro…
lthreonylasparaginylthreonylalanylglyc…
inylalanylhistidylleucylglutaminylvaly…
llysyllysylglutaminylglutamylphenylala…
istidylglutamylarginylhistidylvalylglu…
rtyllysylthreonylleucylarginylmethiony…
glycylthreonylglutamylserylvalylprolyl…
lysylglutamylalanylleucylarginylglutam…
ylprolylalanylvalylserylthreonyllysylt…
ylalanylarginylleucylglutamylisoleucyl…
lutamylarginyllysylleucylarginylmethio…
glutamylprolylarginyllysyltyrosyllysyl…
glutamylglutamylaspartylglutaminylargi…
anylvalylprolylmethionylserylaspartylm…
lysylisoleucylarginylaspartylglutaminy…
yllysylleucylaspartylarginylvalylvalyl…
ginylisoleucylarginylleucylserylarginy…
alanyltyrosylvalylmethionylprolylleucy…
rtylglutaminyltyrosylarginylprolyllysy…
sylleucylserylglutaminylaspartylaspart…
ylprolylalanylarginylarginylarginylthr…
ylaspartylphenylalanyltyrosyltyrosylar…
ylleucylglycylaspartylisoleucylserylas…
eucylprolylisoleucylaspartylaspartylty…
nylthreonylglutamylglutamylglutamylarg…
amylglutamylleucylglutamylleucylglycyl…
rolylserylarginylserylprolylprolylhist…
serylleucylarginyltyrosylserylserylpro…
ylvalylglutamylglutamylthreonylarginyl…
tyrosylserylthreonyltyrosylhistidyliso…
amylalanylserylthreonylseryltyrosylala…
inylhistidylalanylglutaminylalanylalan…
ylglutaminylarginylglutaminylarginylis…
ylglutamylaspartylglutamylglutamylleuc…
hreonylthreonylglutaminylhistidylleucy…
amylleucylaspartylphenylalanylmethiony…
ylarginyllysyllysylserylarginylarginyl…
nylglutamylisoleucylthreonylglutamylis…
sylglutamylisoleucylseryllysylhistidyl…
lserylserylserylalanylserylarginylleuc…
lserylleucylserylprolylthreonyltyrosyl…
inylprolylvalylserylglutamylleucylisol…
minylprolylalanylglutamylglutamyltyros…
lutamylarginylarginylserylprolylthreon…
nylprolylarginylserylprolylserylprolyl…
leucylserylarginylphenylalanylglutamyl…
ylaspartylisoleucylphenylalanylserylar…
ysylalanylalanylleucyllysylthreonylglu…
ginyllysyltyrosylglutamylvalylleucylse…
alanylthreonylleucylaspartylhistidylal…
eucylarginylmethionylarginylserylhisti…
lglutaminylasparaginylthreonylarginylp…
ylvalylglutaminylseryllysylprolylthreo…
yltyrosylhistidylasparaginylglycylvaly…
rylseryllysylisoleucylhistidyltyrosylt…
ylvalylleucylthreonylleucylglutamyliso…
ylthreonylaspartylaspartylserylglycylt…
teinylthreonylasparaginyltyrosyllysylg…
osylalanylthreonylleucylaspartylvalylt…
hreonylthreonyltyrosylalanylserylgluta…
glutamylvalylprolylarginylserylvalylph…
nylarginylthreonylglutamylalanyltyrosy…
lysyllysylthreonylserylglutamylmethion…
larginylglutamylvalyllysylserylglutami…
larginylglutamylserylleucylserylserylt…
rylalanylglutamylmethionyllysylserylal…
ylserylleucylglutamylglutamyllysylsery…
cyllysylthreonylthreonylleucylalanylal…
ysylprolylarginylserylmethionylthreony…
serylalanylarginylphenylalanylserylcys…
lglutamylprolylvalylprolylthreonylvaly…
ylglycylglutaminylvalylleucylserylthre…
minylvalylthreonylthreonylthreonyllysy…
nylglutamylisoleucylserylserylvalylglu…
lycylasparaginyltyrosylserylvalylvalyl…
ylglycyllysylglutaminylglutamylalanylg…
reonylisoleucylglutaminyllysylalanylar…
ylvalylthreonylserylprolylprolylarginy…
larginylvalyllysylserylprolylglutamyla…
nylvalyllysylserylprolylglutamylprolyl…
serylprolylthreonylglutamylthreonyllys…
yllysylvalylglutaminylhistidylleucylpr…
ylisoleucylthreonylglutaminylphenylala…
eryllysylglutamylisoleucylalanyllysyll…
tamylserylserylvalylleucylarginylalany…
yltyrosyllysylaspartylglycyllysyllysyl…
lhistidylphenylalanylglutaminylphenyla…
rtylglycylthreonyltyrosylglutamylleucy…
ylleucylthreonylglutamylserylaspartylg…
cysteinylglutamylisoleucylserylglycylg…
ylthreonylasparaginylleucylglutaminylp…
lalanylphenylalanyllysylserylisoleucyl…
lisoleucylserylglutamylthreonyllysylly…
onylthreonylglutamylserylthreonylvalyl…
lprolyllysylalanylprolylglutamylprolyl…
isoleucylvalylthreonylglycylleucylglut…
serylserylaspartylserylvalylalanyllysy…
threonylglycylglutamylprolylarginylpro…
lthreonyllysylaspartylglycyllysylalany…
lycyllysyltyrosyllysylleucylserylgluta…
lanylphenylalanylleucylglutamylisoleuc…
onylserylaspartylserylglycylleucyltyro…
sylasparaginylserylalanylglycylserylva…
cylthreonylisoleucyllysylalanylisoleuc…
ylglutaminyllysylvalylserylthreonylglu…
oleucylthreonylprolylglutaminyllysylly…
ylglutamylisoleucylserylglutaminyllysy…
utamylisoleucyllysylmethionylserylglut…
myllysylleucylalanylleucyllysylglutamy…
lisoleucylserylglutamylglutamylvalylly…
rylleucylglutamyllysylserylisoleucylva…
lthreonyllysylthreonylserylglutaminyla…
nylthreonylhistidylalanylglutamylisole…
eonylglutaminylmethionylserylisoleucyl…
arginylleucylvalylleucyllysylalanylasp…
threonylaspartylvalyllysyltryptophylva…
amylleucylthreonylasparaginylserylglut…
ycylvalylserylglycylserylaspartylgluta…
llysylglutaminylalanylserylhistidylarg…
leucylthreonylcysteinylisoleucylseryll…
eucylvalyllysylcysteinylglutaminyltyro…
llysylglutamylleucylserylaspartylalany…
erylglutaminylprolylarginylserylglutam…
glutamylglycylglutaminylasparaginylval…
ylglutamylisoleucylserylglycylglutamyl…
lutamyltryptophylphenylalanyllysylaspa…
ucylserylisoleucylserylserylasparaginy…
ylarginylasparaginylvalyltyrosylseryll…
ginylalanylserylvalylserylaspartylsery…
llysylalanyllysylasparaginylphenylalan…
erylalanylthreonylalanylserylleucylmet…
lutamylglutamylprolylserylarginylgluta…
erylglycylaspartylthreonylserylleucylg…
ylserylglutaminylserylvalylglutaminylm…
inylglutamylalanylserylphenylalanylser…
erylalanylserylserylmethionylthreonylg…
anylserylmethionylserylalanylglutaminy…
lutaminylglutamylserylphenylalanylvaly…
rylphenylalanylmethionylglycylisoleucy…
lutaminylleucylglutamylserylserylthreo…
anylglycylisoleucylarginylglycylisoleu…
ylalanylleucylprolylserylaspartylisole…
lycyllysylvalylleucylthreonylvalylalan…
ylglycylglutamylprolylthreonylprolylgl…
ysteinylglycylglycylarginyllysylisoleu…
lutaminylglycylarginylphenylalanylhist…
eonylaspartylaspartylleucylthreonylthr…
nylaspartylvalylglutaminyllysylglutami…
lthreonylleucylserylleucylglycylaspara…
laspartylserylalanylthreonylvalylaspar…
inylserylisoleucine

[size=5]Source(s):[/size]
http://en.wikipedia.org/wiki/Titin
  • 62 people rated this as good

Asker's Rating:Asker's Comment:i am supprised it was on that page because, i also have went on that page, but didn't find it…



[size=5]Other Answers (3)[/size]

  • Titin, also known as connectin, (UniProt name: Q10466_HUMAN; accession number: Q10466) is a protein that is important in the contraction of striated muscle tissues. Titin connects the Z line to the M line in the sarcomere. The protein limits the range of motion of the sarcomere in tension, thus contributing to the passive stiffness of muscle. Variations in the sequence of titin between different types of muscle (e.g. cardiac or skeletal) has been correlated with differences in the mechanical properties of the muscles. Titin is the largest known protein, consisting of 26,926 amino acids. The molecular weight of the mature protein is approximately 2,993,451.39 Da, and it has a theoretical pI of 6.35 [1]. The protein's chemical formula is C132983H211861N36149O40883S693. It has a theoretical instability index (II) of 39.69, indicating that it would be stable in a test tube. The protein's in vivo half-life, the time it takes for half of the amount of protein in a cell to disappear after its synthesis in the cell, is predicted to be approximately 30 hours (in mammalian reticulocytes). As the largest known protein, titin has the longest full chemical name. The full chemical name, containing 189,819 letters, is sometimes claimed to be the longest word in the English language: Methionylthreonylthreonylglutaminylala… ylglutaminylprolylleucylglutaminylsery… lserylthreonylalanylthreonylphenylalan… rylglycylphenylalanylprolylvalylprolyl… lanylarginylaspartylglycylglutaminylva… nylleucylprolylglycylvalylglutaminylis… ylglycylarginylalanyllysylleucylthreon… llysylalanylasparaginylserylglycylargi… eonylasparaginylglycylserylglycylgluta… nylglutamylleucylleucylvalyllysylalany… asparaginylphenylalanylvalylglutaminyl… ylthreonylvalylarginylglutaminylglycyl… utaminylvalylarginylvalylthreonylglycy… lylvalyllysylphenylalanyltyrosylarginy… cylglutaminylserylserylleucylaspartylp… glutaminylglutamylglycylaspartylleucyl… anylglutamylalanyltyrosylprolylglutamy… serylvalylasparaginylalanylthreonylasp… ylthreonylserylthreonylalanylglutamyll… tamylglutamylglutamylvalylprolylalanyl… eucylvalylserylthreonylalanylglutaminy… glutaminylthreonylarginylisoleucylglut… ylhistidylphenylalanylaspartylalanylar… lylglutamylmethionylvalylisoleucylaspa… nylglutaminylleucylprolylhistidyllysyl… lprolylprolyllysylprolyllysylserylargi… erylisoleucylalanylalanyllysylalanylgl… ylglutaminylserylprolylserylprolylisol… lprolylvalylarginylhistidylvalylarginy… lylvalylarginylserylvalylserylprolylal… onylserylprolylisoleucylarginylserylva… thionylarginyllysylthreonylglutaminyla… ylglycylprolylglutamylvalylprolylproly… tamylglycyltyrosylvalylalanylserylsery… ylarginylglutamylthreonylthreonylleucy… minylisoleucylarginylthreonylglutamylg… cylarginyltyrosylglycylvalylglutaminyl… eucylserylglycylalanylalanylglycylalan… serylalanylseryltyrosylalanylalanylglu… lalanyllysylglutamylvalyllysylglutamin… lanylalanylvalylalanylthreonylvalylval… lalanylarginylvalylarginylglutamylprol… tamylglutaminylthreonylalanylglutaminy… eonylalanylvalylhistidylisoleucylgluta… glutaminylvalylarginyllysylglutamylala… threonyllysylvalylvalylvalylalanylalan… lutaminylglutamylleucyllysylserylargin… leucylthreonylthreonyllysylglutaminylg… alylthreonylhistidylglutamylglutaminyl… ylglutamyllysylthreonylphenylalanylval… ylalanylalanyllysylalanyllysylglutamyl… oleucylserylglutamylglutamylisoleucylt… taminylvalylthreonylglutaminylglutamyl… ylthreonylarginyllysylthreonylvalylval… nylthreonylprolyllysylvalyllysylglutam… larginylglycylarginylglutamylglycyliso… lutamylglutaminylvalylglutaminylisoleu… ethionylarginyllysylglutamylalanylglut… hreonylisoleucylalanylvalylalanylthreo… utaminylglutamylthreonylisoleucylleucy… onylmethionylalanylthreonylarginylglut… utaminylvalylthreonylhistidylglycyllys… lalanylglutamylalanylvalylalanylthreon… ylglutaminylalanylarginylvalylarginylg… lycylhistidylleucylglutamylglutamylser… threonylthreonylleucylglutamyltyrosylg… leucylserylalanylalanyllysylvalylalany… nylprolylalanylserylglutamylprolylhist… llysylprolylarginylvalylisoleucylgluta… nylhistidylisoleucyllysylthreonylthreo… hionylhistidylisoleucylserylserylgluta… eonylaspartylleucylthreonylthreonylglu… laspartyllysylarginylprolylarginylthre… alanylthreonylvalylseryllysylisoleucyl… ylhistidylglycyltyrosylglutamylalanyls… lisoleucylalanylthreonylleucylglutamin… eonylserylserylalanylglutaminyllysylis… alanylprolylthreonylvalyllysylprolylse… nylalanylglutamylprolylthreonylprolyll… olylphenylalanylalanylaspartylthreonyl… erylglutamylalanylglycylvalylglutamylv… lylserylisoleucylthreonylglycylthreony… ylarginylphenylalanylglutamylvalylleuc… yllysylvalylthreonylglutamylthreonylal… alylglutamylisoleucylprolylvalylthreon… rylglycylleucyllysylasparaginylvalylth… lutamylserylvalylthreonylleucylglutamy… cyltyrosylprolylserylprolylthreonylval… lutamylaspartyltyrosylglutaminylisoleu… tylphenylalanylglutaminylisoleucylthre… ylisoleucylalanylarginylleucylmethiony… ylalanylalanylglutamylaspartylserylgly… inylserylalanylvalylasparaginylglutamy… onylserylcysteinyltyrosylleucylalanylv… tamylphenylalanylglutamyllysylglutamyl… glutamyllysylphenylalanylthreonylthreo… ylalanylvalylglutamylserylarginylaspar… tylthreonylserylleucylthreonylglutamyl… lglycylglutamylprolylalanylalanylproly… yllysylprolylvalylvalylglutaminyllysyl… lvalylvalylphenylalanylglycylcysteinyl… nylprolyllysylprolylhistidylvalyltyros… lylprolylleucylthreonylthreonylglycylt… tyrosylasparaginyllysylglutaminylthreo… ylvalylisoleucylserylmethionylthreonyl… lanylglycylglutamyltyrosylthreonylisol… sylhistidylglycylglutamylthreonylseryl… lutamylglutamylalanylaspartyltyrosylgl… ylglutaminylglutaminylglutamylmethiony… taminylvalylthreonylalanylphenylalanyl… ylvalylglycylglutamylthreonylalanylpro… rylglutamyltyrosylglutamyllysylglutamy… inylalanylleucylisoleucylarginyllysyll… eonylvalylvalylvalylarginylthreonyltyr… glutamylphenylalanylhistidylisoleucyls… ylarginylleucylisoleucyllysylglutamyli… ucylisoleucyllysylthreonylthreonylleuc… mylglutamylaspartylglycylglutamylgluta… lisoleucylserylglutamylserylglutamylal… lanylaspartylleucylarginylisoleucyllys… lleucylglutamylglycylmethionylglycylva… einyllysylmethionylserylglycyltyrosylp… yltryptophyltyrosyllysylaspartylglycyl… lycylglutamylarginyltyrosylglutaminylm… lutaminylaspartylglycylarginylalanylse… lvalylleucylprolylglutamylaspartylglut… lanylphenylalanylalanylserylasparaginy… nylisoleucylcysteinylserylglycyllysyll… ylalanylprolylleucylglycylalanylprolyl… nylleucylglutamylprolylvalylserylargin… rolylarginylserylvalylserylarginylsery… ylprolylalanylarginylmethionylserylpro… lalanylarginylmethionylserylprolylalan… arginylarginylleucylglutamylglutamylth… ylleucylglutamylarginylleucyltyrosylly… yllysylprolylvalylserylphenylalanyllys… ylasparaginylcysteinylarginylphenylala… cylarginylprolylmethionylprolylglutamy… ylalanylhistidylaspartylglycylglutamin… ylaspartyltyrosylthreonylhistidyllysyl… artylglycylthreonylglutaminylserylleuc… ylthreonylprolylserylaspartylserylglyc… lylalanylglutaminylasparaginylarginyla… ylserylvalylisoleucylleucylthreonylval… ylglutaminylvalyllysylprolylmethionylp… lysylasparaginylvalylasparaginylisoleu… eucylglutamylmethionyllysylvalylarginy… lylasparaginylprolylaspartylisoleucylv… lserylaspartylisoleucylisoleucylvalylp… lisoleucylarginylisoleucylglutamylglyc… alanylleucyllysylisoleucylaspartylsery… ylserylalanyltryptophyltyrosylthreonyl… ginyllysylalanylglycylarginylaspartylt… lvalylasparaginylvalylglutamylvalylglu… ylglutamylprolylglutamylarginyllysylle… glycylthreonyltyrosylarginylalanyllysy… lglutamylleucylglutamylprolylleucylhis… aminylglutamylglutaminyltryptophylglut… osylaspartyllysylglutamyllysylglutamin… phenylalanyllysyllysyllysylleucylthreo… inylphenylalanylglycylprolylalanylhist… ginylleucylthreonylprolylisoleucylsery… ylvalylglutamyltryptophylleucylhistidy… tamylalanylalanylasparaginylarginylleu… inylglutamylphenylalanylglycyltyrosylc… lycylvalylalanyltyrosylserylarginylasp… hreonylcysteinylarginylalanylthreonyla… laspartylhistidylthreonylserylalanylth… rtylglutamyllysylserylleucylvalylgluta… lylglutamylglycylarginyllysylglycylleu… ylglutamylleucylglutamylarginylmethion… lleucylthreonylglycylvalylthreonylthre… lysylglutaminyllysylprolylaspartylisol… ylprolylvalylarginylvalylleucylglutamy… lphenylalanylarginylcysteinylarginylva… minylprolyllysylvalylasparaginyltrypto… lutaminylleucylisoleucylarginyllysylse… alylarginyltyrosylaspartylglycylisoleu… leucylvalylaspartylcysteinyllysylseryl… ylvalyllysylvalylthreonylalanylglutamy… ylisoleucylglutamylhistidyllysylvalyll… ylglutaminylarginylglutamylaspartylphe… inylarginylalanylprolylglutamylprolyla… tidylvalylhistidylglutamylprolylglycyl… utamylvalylglutaminyllysylvalylasparty… threonylglutamylthreonyllysylglutamylv… nylglutamylarginylisoleucylthreonylhis… ylglutamylserylglutamylglutamylleucyla… ginylarginylthreonylglutamylglutamylgl… leucylthreonylalanylvalylglutamylleucy… lglutamylseryltyrosylglutamylglutamyll… laspartylglutamylleucylleucylhistidylt… lthreonylglutamylglutamylglutamyllysyl… amylglycyllysylisoleucylthreonylisoleu… rolylaspartyllysylisoleucylglutamylleu… lalanylprolyllysylisoleucylphenylalany… serylglutaminylthreonylvalylglycylglut… idylphenylalanylarginylvalylarginylval… lylglutamylcysteinylglutamyltryptophyl… ysylisoleucylglutamylarginylserylaspar… ltyrosyltryptophylprolylglutamylaspart… leucylvalylisoleucylarginylaspartylval… ylalanylserylisoleucylmethionylvalylly… cylalanylglycylglutamylthreonylserylse… leucylvalylglutaminylalanyllysylglutam… anylthreonylglutaminylglutamylleucylgl… ylglutamyllysylaspartylthreonylmethion… lcysteinylglutamylthreonylserylglutamy… ysyltryptophyltyrosyllysylaspartylglyc… tamylglycylaspartyllysyltyrosylarginyl… yllysylvalylhistidylphenylalanylleucyl… ylaspartylthreonylserylaspartylalanylg… lvalylleucylvalylglutamylaspartylgluta… eonylalanyllysylleucylisoleucylvalylgl… lphenylalanylvalyllysylglutamylleucylg… alylprolylglutamylseryltyrosylserylgly… soleucylvalylserylprolylglutamylaspara… yptophyltyrosylhistidylasparaginylaspa… paraginylglycyllysyltyrosylthreonyliso… ycylarginylglutaminylasparaginylleucyl… onyllysylglutamylaspartylglutaminylgly… valylisoleucylaspartylglycyllysyllysyl… llysylmethionyllysylprolylarginylproly… aminylglycylleucylserylaspartylglutami… laspartylisoleucylvalylglutaminylleucy… glutamylserylvalylglutamylglycylvalylt… ylglutaminylglutamylvalylglutaminylpro… lisoleucylvalylisoleucylaspartyllysylg… ylleucylisoleucylglutamylaspartylmethi… anylglycylasparaginyltyrosylserylpheny… lleucylglycylleucylserylthreonylserylg… erylvalylaspartylvalylisoleucylthreony… raginylvalylisoleucylglutamylglycylthr… cysteinyllysylvalylserylvalylprolylasp… yptophyltyrosylleucylasparaginylaspart… rolylaspartylaspartylarginylvalylgluta… lthreonyllysylglutaminylarginylleucylv… onylhistidylalanylserylaspartylglutamy… eucylvalylglycylarginylvalylglutamylth… ylleucylserylvalylglutamyllysylisoleuc… cylleucylarginylaspartylleucylthreonyl… utaminylasparaginylvalylvalylphenylala… histidylserylglycylisoleucylaspartylva… lalanyllysylaspartyllysylglutamylisole… yllysylisoleucylglutamylalanylhistidyl… cylthreonylvalylleucylasparaginylmethi… lutamylglycyllysyltyrosylthreonylpheny… sparaginylmethionylthreonylserylglycyl… lglycylalanylisoleucylseryllysylprolyl… eonylvalylalanylglutamylserylglutaminy… tamylcysteinylglutamylvalylalanylaspar… lglutamyltryptophylleucylarginylaspart… ucylthreonylasparaginylasparaginylisol… tylglycylhistidyllysylarginylarginylle… hreonyllysylleucylaspartylaspartylisol… yrosyllysylvalylalanylthreonylseryllys… ylvalylglutamylalanylvalyllysylisoleuc… raginylleucylthreonylvalylthreonylglut… lvalylphenylalanylthreonylvalylglutamy… ginylvalyllysylglycylvalylglutaminyltr… ycylvalylvalylleucylglutamylserylaspar… leucylserylvalyllysylglycylthreonyliso… eucyllysylasparaginylcysteinylalanylis… lyltyrosylglycylphenylalanylarginylleu… erylalanylarginylleucylhistidylvalylgl… oleucyllysyllysylprolyllysylaspartylva… raginylalanylthreonylvalylalanylphenyl… istidylaspartylthreonylvalylprolylvaly… llysylserylvalylglutamylisoleucyllysyl… inylleucylvalylserylglutamylarginyllys… leucylglutaminylasparaginylisoleucylse… lutamyltyrosylthreonylalanylvalylvalyl… inyllysylalanyllysylleucylphenylalanyl… isoleucylthreonyllysylthreonylmethiony… alylprolylglutamylthreonyllysylthreony… teinylglutamylvalylserylhistidylphenyl… thionyltryptophylleucyllysylasparaginy… ylmethionylserylglutamyllysylphenylala… ylglycyllysylleucylhistidylglutaminyll… araginylthreonylserylthreonylglutamyla… reonylphenylalanylvalylcysteinylglycyl… erylalanylthreonylleucylthreonylvalylt… eucylthreonylserylmethionylleucyllysyl… lutamylglutamyllysylaspartylthreonylis… valylthreonylvalylasparaginyltyrosylgl… syltryptophylleucyllysylasparaginylgly… threonylaspartyllysylcysteinylglutamin… lleucylthreonylhistidylserylleucylaspa… alylhistidylphenylalanylglycylaspartyl… phenylalanylvalylalanylglycyllysylalan… ylleucyltyrosylvalylglutamylalanylargi… lanylarginyllysylhistidylisoleucyllysy… lutamyllysyllysylarginylalanylmethiony… mylvalylserylglutamylprolylaspartyliso… phylmethionyllysylaspartylaspartylglut… ucylthreonylaspartylarginylisoleucylly… lysyltyrosylvalylhistidylarginylleucyl… rginylmethionylserylaspartylalanylglyc… nylglycylglycylasparaginylvalylserylth… valylglutamylglycylarginylaspartylvaly… cyllysyllysylglutamylvalylglutaminylva… arginylalanylvalylvalylglutamylphenyla… ylaspartylaspartylvalylaspartylalanylh… ylglycylisoleucylglutamylisoleucylaspa… lutaminylglutamylarginylhistidyllysylt… nylisoleucylhistidylarginylmethionylph… eonylarginylglutaminylserylaspartylala… nylalanylvalylalanylglycylarginylaspar… lleucyltyrosylvalylasparaginylalanylpr… alylleucylglutaminylglutamylleucylglut… minylserylglycyllysylprolylalanylargin… nylisoleucylserylglycylarginylprolylgl… yptophyltyrosyllysylglutamylglutamylgl… ycylphenylalanyllysylcysteinyllysylphe… ylglutaminylglutamyltyrosylthreonylleu… nylphenylalanylprolylglutamylaspartyla… einylglutamylalanyllysylasparaginylasp… ylthreonylserylalanylserylleucylserylv… lvalylserylprolylaspartylglutaminylglu… lylprolylalanylisoleucylisoleucylthreo… reonylvalylthreonylserylglutamylglycyl… alanylglutaminylcysteinylarginylvalyls… ylvalylseryltryptophyltyrosylseryllysy… olylserylarginylphenylalanylphenylalan… lphenylalanylglutamylaspartylthreonylt… ucylalanylglutamylalanyltyrosylprolylg… yltyrosylthreonylphenylalanylvalylalan… glycylglutaminylvalylserylserylthreony… glutamylalanylprolylglutamylserylisole… oleucylglutamylglutaminylglutamylisole… nyllysylglutamylphenylalanylserylseryl… lutamylglutamylglutamylglycylleucylhis… minylleucylseryllysylisoleucylasparagi… ucylleucylserylglutamylserylprolylvaly… anylaspartylserylglutamyllysylglutamyl… phenylalanylisoleucyllysylglutamylvaly… eucylserylmethionylglycylaspartylvalyl… nylvalylisoleucylglycylisoleucylprolyl… tryptophylphenylalanylphenylalanylaspa… nylprolylserylalanylaspartyltyrosyllys… rtylglycylaspartylaspartylhistidylsery… ylalanylthreonyllysylleucylglutamylasp… hreonylcysteinylmethionylalanylserylas… threonylisoleucylcysteinylserylalanylt… ylseryllysylglycylglutamylglycylhistid… onylglutamylserylalanylvalylalanyllysy… ylglycylprolylcysteinylprolylprolylhis… lleucyllysylprolylisoleucylarginylcyst… olylalanylisoleucylphenylalanylglutamy… tamylprolylalanylprolylthreonylvalylth… utamylasparaginyllysylglutaminylleucyl… yrosylthreonylisoleucylisoleucylhistid… lserylglycylthreonylphenylalanylisoleu… utaminylarginylglutamylaspartylserylgl… lysylalanylglutamylasparaginylmethiony… ysteinylalanylalanylglutamylleucylleuc… threonylaspartylmethionylthreonylaspar… yllysylserylthreonylprolylglutamylalan… lprolylglutaminylthreonylprolylleucyll… alanylleucylaspartylserylglutamylgluta… lphenylalanylvalyllysylaspartylthreony… ucylisoleucylthreonylglutamylglutamyla… lseryltyrosylglutamylhistidylisoleucyl… lleucylserylserylglutaminylleucylproly… ylleucylglutaminylserylisoleucylleucyl… ylthreonylprolylglutamylserylthreonyla… teinylisoleucylasparaginylglycylseryli… nylprolylleucyllysylglutamylprolylsery… eucylglutaminylisoleucylvalylglutaminy… alanylseryllysylglutamylglycylisoleucy… mylprolylglutamylthreonylglutaminylala… glutamyllysylisoleucylphenylalanylprol… lglutamylglutaminylisoleucylasparaginy… olylleucyllysylthreonylleucylleucylala… raginyltyrosylprolylglutaminylserylser… ionylhistidylseryltyrosylleucylthreony… lylleucylserylleucyllysylglutamyllysyl… sparaginylarginylglutamylglutaminylarg… sylglutaminylglutamylalanylglutaminyls… lglutaminylserylleucylalanylglutamylgl… lglutaminylserylprolylaspartylvalylmet… asparaginyltyrosylglutamylprolylleucyl… ylcysteinylthreonylglutamylglycylglycy… mylserylalanylasparaginylprolylleucylg… minylaspartylserylalanylvalylarginylis… erylleucylarginylphenylalanylprolylleu… lglutaminylvalylleucylleucyllysylgluta… araginylvalylvalylmethionylprolylproly… ylglutamylseryllysylarginylglutamylpro… lylglutaminylglutamylvalylglutaminylgl… llysylglutamylserylleucylleucylserylgl… glutaminylarginylleucylasparaginylleuc… cysteinylarginylalanylleucylglutaminyl… lglutaminylprolylglycylleucylphenylala… inylasparaginylisoleucylglutamyllysylv… lasparaginylisoleucylthreonylglutaminy… ucylmethionylcysteinylmethionyltyrosyl… serylvalylthreonylglutamylglutamylvaly… lglutamylaspartylvalylaspartylprolylgl… eucyllysylmethionylglutamylleucylargin… ylisoleucylisoleucyltyrosylglutamylglu… ylthreonylalanylglutamylglycylprolylar… lycylalanyllysylthreonylserylleucylglu… artylserylphenylalanylserylglycylseryl… soleucylthreonylglutamylprolylglutamyl… lisoleucylserylthreonylglutamylglutamy… aginylvalylglutaminylserylarginylvalyl… eonylprolylvalylthreonyllysylglycylval… spartylglutamyllysylglutaminylaspartyl… glutamylglutamyllysylglutamylglutamyls… reonylglutamylglutamylvalylalanylthreo… tamylalanylglutamylglycylglycylleucyli… prolylmethionylisoleucylhistidylthreon… valylserylglutamylglutamylglycylaspart… nylthreonylserylisoleucylthreonylaspar… aginyltryptophyltyrosylphenylalanylglu… lylserylaspartylglutamyllysylphenylala… partylglutaminylasparaginylthreonyltyr… artyllysylvalylasparaginylthreonylglut… lglutamyltyrosylvalylcysteinylglutamyl… lglycyllysylthreonylalanylthreonylsery… llysylarginylalanylalanylprolylvalylis… utamylprolylleucylglutamylvalylalanyll… lphenylalanylthreonylcysteinylglutamyl… lasparaginylvalylarginylphenylalanylgl… alanylglycylarginylglutamylisoleucylty… einylserylisoleucylarginylserylserylly… glutamylisoleucylleucylarginylthreonyl… ylglycylglutamyltyrosylthreonylcystein… yltyrosylglycylserylvalylserylcysteiny… ylvalylthreonylvalylprolylglycylglycyl… leucylleucylprolylglutamylarginyllysyl… utamylvalylvalylleucyllysylserylvalyll… mylglutamylglutamylglutamylprolyllysyl… glutamyllysylvalyllysyllysylprolylalan… olylprolyllysylprolylvalylglutamylglut… lvalylthreonyllysylarginylglutamylargi… ylthreonyllysylvalylprolylglutamylisol… ylleucylprolylalanylprolylglutamylprol… nylglutamylvalyllysylthreonylisoleucyl… lprolylglutamylprolylthreonylprolyliso… ylvalylprolylvalylvalylglycyllysyllysy… lyllysylglutamylglutamylalanylalanylly… lysylglycylvalylprolyllysyllysylthreon… lalanylglutamylarginylarginyllysylleuc… cylglutamyllysylprolylprolylaspartylgl… nyltyrosylglutaminylleucyllysylalanylv… lyllysylglutamylisoleucyllysylaspartyl… tamylserylglutamylphenylalanylvalylgly… lanylglutamylcysteinylleucylvalylseryl… hreonylthreonyltryptophylmethionyllysy… eucylarginylglutamylserylprolyllysylhi… lanylaspartylglycyllysylaspartylarginy… cylaspartylvalylglutaminylleucylseryla… hreonylcysteinylvalylleucylarginylleuc… ylthreonylserylthreonylalanyllysylleuc… rolylvalylarginylphenylalanylvalyllysy… amylvalylthreonylvalylvalyllysylglycyl… serylcysteinylglutamylleucylasparaginy… alyltryptophylarginyllysylaspartylglyc… ysylprolylglycylarginylisoleucylvalylp… ylmethionylarginylalanylleucylthreonyl… spartylaspartylthreonylaspartylalanylg… reonylvalylglutamylasparaginylalanylas… ysteinylserylserylcysteinylvalyllysylv… nylaspartyltryptophylleucylvalyllysylp… inylhistidylvalyllysylprolyllysylglycy… lalanylcysteinylaspartylisoleucylalany… inylisoleucyllysyltryptophylphenylalan… lisoleucylprolylalanylglutamylprolylas… mylisoleucylleucylarginylaspartylglycy… ucyllysylisoleucyllysylasparaginylalan… oleucylalanylglutamyltyrosylalanylvaly… ylarginyltyrosylprolylalanyllysylleucy… lglutamylvalylglutamylleucylleucyllysy… ylthreonylisoleucyltyrosylglutamyllysy… ylaspartylalanylglutamylisoleucylseryl… ylglycylglutaminyltryptophyllysylleucy… inylprolylserylprolylthreonylcysteinyl… lglycylglycyllysylarginylphenylalanyll… yllysylleucylaspartylglutaminylalanylg… aminylalanylleucylasparaginylalanyliso… ylleucylthreonylvalyllysylglutamylisol… anylalanylvalylprolylleucyllysylaspart… rginylarginylglutaminylalanylarginylph… cylthreonylarginylglutamylalanylaspara… ysylglycylprolylaspartylisoleucylisole… nylalanylaspartylisoleucylisoleucylala… isoleucylleucylvalylisoleucylasparagin… ylaspartylaspartylglutamylglycylvalylt… utamylglycyllysyllysylthreonylserylala… reonylglycylisoleucylarginylleucyllysy… ucylglutamylaspartylglutaminylthreonyl… eonylalanylthreonylphenylalanylvalylcy… lutamyllysylmethionylhistidylvalylvaly… inylaspartylalanyllysylleucylhistidylt… cylisoleucylserylserylglutamylglycylly… mylmethionyllysylglutamylvalylthreonyl… lglutaminylisoleucyllysylalanylglutami… ylthreonylalanylglutaminylleucyllysylv… lyltyrosylphenylalanylthreonylvalyllys… ylalanylvalylglutamyllysylaspartylglut… teinylglutamylvalylseryllysylaspartylv… lalanyllysylaspartylglycylglutamylglut… lysyltyrosylserylisoleucyllysylalanyla… oleucylleucyllysylisoleucyllysyllysyla… ylglycylglutamyltyrosylvalylcysteinyla… tyllysylthreonyllysylalanylasparaginyl… inylleucylisoleucylglutamylvalylglutam… ylglutamylvalylphenylalanylvalylglycyl… lalanylglutamylisoleucylglutamylleucyl… tidylglycylglutaminyltryptophyllysylle… ylthreonylalanylserylprolylaspartylcys… tamylaspartylglycyllysyllysylhistidyli… ylasparaginylcysteinylglutaminylleucyl… ylvalylserylphenylalanylglutaminylalan… alanylalanylasparaginylleucyllysylvaly… leucylphenylalanylisoleucylthreonylpro… ylphenylalanylglutamyllysylaspartylglu… lcysteinylglutamylvalylserylarginylglu… larginyltryptophylleucyllysylglycylthr… eonylglycylaspartylaspartylarginylphen… laspartylglycylthreonyllysylhistidylse… lalanylalanylphenylalanylglutamylaspar… nylphenylalanylglutamylalanylglutamyla… ycyllysylleucylisoleucylisoleucylgluta… lphenylalanylleucylthreonylprolylleucy… sylglutamyllysylglutamylserylalanylval… leucylserylhistidylaspartylasparaginyl… lphenylalanyllysylasparaginylaspartylg… nylthreonylarginylserylvalylserylmethi… llysylthreonylhistidylserylisoleucylth… ylserylisoleucylaspartylaspartylthreon… lylglutamylalanylmethionylglycylmethio… cylthreonylvalylleucylglutamylglycylas… onylglycyllysylleucylglutaminylasparty… lysylaspartylglutamylvalylisoleucylleu… ucylseryllysylalanylaspartylalanylprol… ysylaspartylglycyllysylglutamylisoleuc… lanylvalylisoleucyllysylthreonylaspart… eucylisoleucylleucyllysyllysylalanylle… ylglutaminyltyrosylthreonylcysteinylas… yllysylthreonylserylglycyllysylleucyla… inylglutamylisoleucyllysylleucylvalyla… lglutamylvalylmethionylglutamylthreony… lalanylglutamylthreonylglutamylisoleuc… eucylhistidylalanylasparaginyltryptoph… nylleucylleucylglutaminylthreonylproly… lysylglutamylglutamylglycyllysylisoleu… stidylasparaginylcysteinylarginylleucy… ycylvalylaspartylphenylalanylglutaminy… erylserylalanylhistidylleucylarginylva… glycylleucylleucylarginylprolylleucyll… nylalanylglycylglutamylthreonylalanylt… lglutamylleucylseryltyrosylglutamylasp… yptophyltyrosylleucyllysylglycyllysyll… yllysylvalylvalylprolylarginylserylglu… ylleucylthreonylleucylarginylaspartylv… ylglycylglutamylvalylglutaminylleucylt… nyllysylthreonylhistidylalanylasparagi… amylprolylprolylvalylglutamylphenylala… laspartylglutaminylthreonylvalylglutam… lvalylleucylglutamylcysteinylglutamylv… alanyllysylvalyllysyltryptophylphenyla… glutamylisoleucylleucyllysylseryllysyl… lanylaspartylglycylarginylvalylarginyl… partylcysteinylthreonylprolylglutamyla… lthreonylcysteinylaspartylalanyllysyla… ylcysteinylasparaginylleucylasparaginy… lglutamylphenylalanylleucylarginylprol… minylvalylarginylglutamyllysylglutamyl… lutamylcysteinylglutamylleucylserylarg… alyllysyltryptophylphenylalanyllysylas… lysyllysylglycyllysyllysyltyrosylaspar… ylalanylvalylarginylisoleucylleucylval… lleucylleucylaspartylaspartylglutamyla… lutamylvalylarginylthreonylalanylargin… lthreonylvalylleucylglutamylglutamylgl… yllysylasparaginylleucylalanylasparagi… mylthreonylaspartylthreonylisoleucylly… lseryllysylprolylglycylalanylglutamylv… glycylaspartylglutamylglutamylisoleucy… inyltyrosylglutamylisoleucylleucylthre… ylisoleucylleucylvalylisoleucylglutami… lutamylaspartylalanylglycylasparaginyl… eucylprolylserylserylarginylthreonylas… tidylglutamylleucylalanylalanylglutamy… lylglutaminylasparaginylleucylglutamyl… yllysylalanylglutamylphenylalanylvalyl… utamylserylphenylalanylprolylvalylglut… laspartyllysylthreonylleucylglutamylse… ylvalylisoleucylalanylaspartylglycylly… llysylaspartylalanylthreonylleucylglut… yltyrosylvalylvalylmethionylvalylglycy… nylhistidylleucylthreonylvalylisoleucy… lvalylvalylprolylleucyllysylaspartylth… aminylglutaminylglutamylvalylvalylphen… lvalylasparaginylthreonylglutamylglycy… enylalanylarginylasparaginylglutamylgl… partylserylseryllysyltyrosylisoleucyli… ylleucylvalyltyrosylthreonylleucylargi… stidylleucylaspartylaspartylglutaminyl… valylserylleucylthreonylasparaginylhis… ylvalyllysylserylalanylalanylasparagin… mylglutamylaspartylleucylarginylisoleu… partylisoleucylglutamylthreonylmethion… nylphenylalanyltryptophylcysteinyllysy… aginylvalylthreonylleucyllysyltryptoph… tamylglutamylvalylprolylphenylalanylas… yrosylarginylvalylaspartyllysyltyrosyl… lisoleucyllysylaspartylcysteinylglycyl… lycylglutamyltyrosylisoleucylvalylthre… ysylserylvalylalanylglutamylleucylleuc… rolylthreonylglutamylphenylalanylvalyl… tylglutaminylthreonylvalylthreonylglut… nylvalylphenylalanylserylcysteinylglut… ylalanylasparaginylvalyllysyltryptophy… inylglutamylisoleucyllysylglutamylglyc… lglutamyllysylaspartylglycylserylisole… soleucyllysylaspartylcysteinylarginyll… nylglutamyltyrosylalanylcysteinylglycy… erylarginylalanylarginylleucylphenylal… rolylvalylglutamylisoleucylisoleucylar… isoleucylleucylglutamylalanylprolylgly… anylleucylalanylglutamylleucylasparagi… alylglutaminyltryptophylleucylarginyla… valylvalylglutaminylglycylaspartyllysy… ylserylglutamylglycyllysylisoleucylhis… ylcysteinylaspartylisoleucyllysylproly… tamyltyrosylarginylphenylalanylisoleuc… lanylarginylalanyllysylleucylglutamyll… soleucyllysylthreonylalanylaspartylglu… rtylvalylglycyllysylprolylleucylthreon… spartylalanyltyrosylprolyllysylalanylg… ylalanyllysylglutamylasparaginylglutam… eonylisoleucylaspartylthreonylthreonyl… ylphenylalanylarginylisoleucylleucylgl… llysylglycylarginyltyrosyllysylisoleuc… ysylhistidylglycyllysylalanylglutamylg… ylleucyllysylvalylisoleucylaspartylval… araginylleucylglutamylvalylthreonylglu… ycylglutamylvalylserylleucylalanyltryp… hreonylaspartylglycylglycylseryllysyli… valylglutamylarginylarginylaspartyliso… tophylvalylleucylalanylthreonylasparty… lglutamylphenylalanylthreonylvalylthre… ylglycylvalylglutamyltyrosylleucylphen… nylasparaginylarginylvalylglycylthreon… threonylaspartylasparaginylprolylvalyl… sylaspartylvalylprolylglycylprolylprol… leucylthreonylaspartylvalylasparaginyl… leucylthreonyltryptophylglutamylprolyl… glycylalanylglutamylisoleucylthreonyla… amylleucylarginylaspartyllysylthreonyl… rtylthreonylalanylmethionylthreonylval… ylserylalanylthreonylvalylthreonylaspa… nylglutamyltyrosylserylphenylalanylarg… araginylarginylisoleucylglycylvalylgly… onylprolylphenylalanylvalyllysylvalyla… larginylprolylserylprolylprolylvalylas… partylglutaminylthreonylglutaminylsery… ptophylglutamylprolylprolylleucyllysyl… eucylleucylglycyltyrosylisoleucylisole… lglutamylglycyllysylaspartylasparaginy… lasparaginylmethionyllysylleucylvalylp… ysylvalylthreonylglycylleucylglutamyll… ucyltyrosylarginylvalylserylalanylglut… ylserylaspartylprolylserylglutamylisol… ylalanylaspartylaspartylalanylphenylal… ionylaspartylleucylserylalanylphenylal… ylvalylisoleucylvalylprolylasparaginyl… cylvalylprolylserylthreonylglycyltyros… threonyltryptophylcysteinylphenylalany… amylthreonylglycylaspartylarginylvalyl… rylalanyltyrosylalanylglutamylleucylva… larginylserylaspartyllysylglycylisoleu… glutamylasparaginylarginylvalyllysylth… soleucylaspartylvalylasparaginylvalyli… nylprolyllysylglutamylleucyllysylpheny… nyllysylaspartylserylvalylhistidylleuc… rolylaspartylaspartylaspartylglycylgly… yrosylvalylvalylglutamyllysylarginylgl… ltryptophylthreonyllysylvalylmethionyl… partylleucylglutamylphenylalanylthreon… taminylglycyllysylglutamyltyrosylleucy… nylarginylasparaginyllysylcysteinylgly… tyrosylvalylaspartylglutamylprolylvaly… rolylalanylthreonylvalylprolylaspartyl… llysyltryptophylarginylaspartylarginyl… ucylphenylalanylleucylthreonyltryptoph… nylaspartylglycylglycylserylarginyliso… lylglutamylarginylcysteinylprolylargin… lvalylalanylcysteinylglycylglutamylpro… methionylglutamylvalylthreonylglycylle… tophyltyrosylalanyltyrosylarginylvalyl… ylglutaminylglycylalanylseryllysylprol… lglutamylisoleucylglutaminylalanylvaly… alanylprolylglutamylisoleucylphenylala… ucylalanylglycylleucylthreonylvalyllys… lglutamylleucylprolylalanylthreonylval… prolyllysylisoleucylthreonyltryptophyl… lisoleucylleucyllysylglutaminylasparty… ucylglutamylasparaginylvalylprolyllysy… leucylvalylaspartylseryllysylarginylse… rosylisoleucylisoleucylglutamylalanylv… arginylalanylthreonylalanylvalylvalylg… spartyllysylprolylglycylprolylprolylal… ucylthreonylaspartylvalylthreonylaspar… eucylthreonyltryptophylasparaginylprol… ylglycylseryllysylisoleucylthreonylasp… ginylarginylalanylthreonylaspartylsery… ylleucylserylserylthreonylvalyllysylas… yllysylalanylthreonyllysylleucylisoleu… rosylisoleucylphenylalanylarginylvalyl… ionyltyrosylglycylalanylglycylglutamyl… lylisoleucylthreonylalanyllysyltyrosyl… lprolylglycylprolylprolylthreonylargin… isoleucylthreonyllysylaspartylalanylva… cysteinylglutamylprolylaspartylasparty… leucylthreonylglycyltyrosyltryptophylv… olylaspartylthreonylaspartyllysyltrypt… yllysylmethionylprolylvalyllysylaspart… yllysylglycylleucylthreonylasparaginyl… alanylarginylvalylleucylalanylglutamyl… glycyllysylprolylseryllysylserylthreon… eucyllysylaspartylprolylisoleucylaspar… ylglycyllysylprolylthreonylvalyllysyla… lvalylarginylleucylasparaginyltryptoph… ylaspartylglycylglycylalanyllysylisole… cylglutamylmethionylleucyllysylthreony… tophylvalylarginylvalylalanylglutamylg… taminylhistidylleucylleucylprolylglycy… minylglutamyltyrosylserylphenylalanyla… ginyllysylalanylglycylglutamylserylglu… aspartylprolylvalylleucylcysteinylargi… prolylserylprolylprolylarginyltryptoph… aginylisoleucylthreonyllysylasparaginy… ryptophylthreonylvalylprolylglutamylly… soleucylthreonylasparaginyltyrosylisol… tylvalylarginylarginyllysylglycyltrypt… lthreonylthreonylvalyllysylaspartylthr… eonylprolylleucylthreonylglutamylglycy… larginylvalylalanylalanylglutamylaspar… ylserylaspartyltyrosylthreonylglutamyl… leucylalanyllysylaspartylthreonylpheny… prolylprolyltyrosylalanylleucylalanylv… arginylhistidylvalylaspartylleucyllysy… lasparaginylaspartylglycylglycylarginy… rosylvalylisoleucylglutamyllysyllysylg… rginyltryptophylvalyllysylalanylglycyl… rtylcysteinylasparaginylphenylalanylar… eucylglutamylglycylthreonylglutamylval… alylarginylalanylglutamylasparaginylgl… ylprolylserylglutamylprolylthreonylglu… lutamylaspartylprolylthreonylserylprol… rtylleucylhistidylvalylthreonylasparty… oleucylalanylisoleucylalanyltryptophyl… aginylglycylglycylserylprolylisoleucyl… glutamylmethionylcysteinylprolylvalylg… lmethionylarginylvalylasparaginylseryl… leucyllysylphenylalanyllysylvalylgluta… partyllysylglutamyltyrosylvalylleucyla… ginylalanylisoleucylglycylvalylserylgl… erylglutamylasparaginylvalylvalylalany… yllysylprolylthreonylisoleucylaspartyl… tylisoleucylisoleucylvalylisoleucylglu… isoleucylprolylvalylprolylphenylalanyl… threonylvalylseryltryptophylhistidylly… lysylalanylserylaspartylarginylleucylt… artylhistidylisoleucylserylalanylhisti… rylvalylarginylalanylaspartylalanylgly… lthreonylleucylglutamylasparaginyllysy… nylserylisoleucylasparaginylvalyllysyl… cylprolylcysteinyllysylaspartylisoleuc… threonyllysylserylserylcysteinyllysyll… ylprolylglutamylphenylalanylaspartylgl… ucylhistidyltyrosylvalylleucylglutamyl… rginylarginylthreonyltyrosylisoleucylp… mylasparaginyllysylleucylseryltryptoph… soleucylprolylasparaginylglycylglutamy… inylvalyllysylalanylvalylasparaginylly… yrosylisoleucylglutamylleucyllysylaspa… utaminylaspartylprolyllysylglutaminylp… laspartylvalylglutamylvalylhistidylasp… lalanylmethionylthreonylisoleucylthreo… ltyrosylaspartylglycylglycylseryllysyl… eucylisoleucylglutamyllysylisoleucylal… nyltryptophyllysylarginylcysteinylaspa… rolylisoleucylleucylthreonyltyrosylthr… lglutamylglycyllysylglutamyltyrosylglu… nylalanylglutamylasparaginylalanylalan… lserylarginylalanylthreonylprolylproly… olylisoleucylaspartylalanylprolyllysyl… serylleucylglutamylvalyllysylarginylgl… leucylaspartylalanylserylisoleucylsery… onylisoleucylthreonyltryptophylisoleuc… alylisoleucylvalylprolylglutamylglutam… lanylprolylleucylvalylarginylarginylar… inylglutamylglutamylglutamylprolylphen… onylglutaminylarginylleucylserylisoleu… ylglycylglutamylserylglutaminylleucyla… ylarginylprolylaspartylhistidylglycyll… valylglutamylasparaginylaspartylhistid… rolylcysteinylthreonylvalylserylvalyll… olylprolylisoleucylasparaginylphenylal… ylisoleucylarginyllysylthreonylserylva… utamylprolylprolylleucylaspartylaspart… lisoleucylasparaginyltyrosylthreonylle… threonyllysylprolylaspartylserylglutam… onylserylthreonylleucylarginylhistidyl… onyllysylleucylisoleucylglutamylglycyl… nylarginylvalylarginylalanylglutamylas… rolylglycylprolylprolylcysteinylvalyls… ylaspartylprolylphenylalanylglycylprol… llysylprolylisoleucylvalylglutamylaspa… rylmethionylleucylvalyllysyltryptophyl… tylasparaginylglycylserylprolylisoleuc… ylglutamyllysylarginylglutamylvalylasp… phylserylarginylvalylasparaginyllysyls… ucyllysylalanylasparaginylvalylasparty… ucylthreonyltyrosylvalylphenylalanylar… paraginylalanylalanylglycylprolylglycy… serylaspartylprolyllysylthreonylalanyl… lprolylprolylglycylprolylprolylisoleuc… lthreonylserylserylthreonylthreonyliso… hylglutamylprolylprolylalanylphenylala… tamylisoleucylvalylglycyltyrosylphenyl… eucylvalylglycylthreonylasparaginyllys… reonylglutamyllysylmethionylisoleucyll… reonylvalyllysylglutamylisoleucylargin… yllysylleucylarginylvalylserylalanylva… tamylglycylprolylprolylglycylglutamylt… lvalylalanylglutamylprolylglutaminylgl… ylleucylaspartylvalylserylvalyllysylgl… cylmethionylalanylglycyllysylthreonyll… lylvalylthreonylglycylarginylprolylval… lthreonyllysylglutamylglutamylglycylgl… ginylvalylvalylisoleucylaspartylaspara… lutamylleucylisoleucylisoleucyllysylas… tylhistidylglycylarginyltyrosylvalylis… ginylserylcysteinylglycylseryllysylphe… alylglutamylvalylphenylalanylaspartylv… partylleucyllysylprolylvalylvalylthreo… cysteinylleucylleucylasparaginyltrypto… rtylaspartylglycylglycylserylglutamyli… soleucylisoleucylglutamylarginyllysyla… threonyltryptophylarginylglutaminylpro… larginylseryllysylcysteinylaspartyliso… tamylglycylglutaminylglutamyltyrosylly… lalanyllysylasparaginyllysylphenylalan… valylglutamylisoleucylglycylprolylisol… lleucylglycylprolylprolylthreonylseryl… tyrosylthreonylglutamylarginylglutamin… onylleucylaspartyltryptophyllysylgluta… cylglycylserylprolylisoleucylglutaminy… tamyllysylarginylarginylhistidylaspart… utamylarginylvalylasparaginyllysylargi… eonylserylphenylalanylleucylvalylgluta… lhistidylglutaminylmethionyltyrosylglu… lanylvalylasparaginylglutamylisoleucyl… rylleucylprolylleucylasparaginylvalylv… rtylglutamylvalylprolylprolylthreonyli… ylvalylarginylglycylaspartylthreonylis… lutamylprolylvalylhistidylisoleucylpro… lleucylprolylmethionylprolyllysylisole… araginylglutamylthreonylvalylisoleucyl… alanylleucylglutaminylisoleucylthreony… inylserylglutamylalanyllysylthreonylgl… ylalanylvalylarginylglutamylaspartylly… ylthreonylalanylserylasparaginylarginy… arginylasparaginylvalylhistidylvalylgl… olylserylprolylprolylarginylasparaginy… soleucyllysylalanylglutamylserylcystei… spartylalanylprolylleucylaspartylaspar… eucylthreonylhistidyltyrosylvalylisole… nylserylarginyllysyllysylalanylglutamy… eonylasparaginylthreonylalanylvalylglu… ucyltryptophyllysylleucylisoleucylprol… lglutamylphenylalanylarginylvalylargin… lglycylisoleucylserylaspartylglutamylc… lvalylisoleucylglutaminylaspartylproly… olylprolylglycyllysylprolyllysylvalyll… ylserylmethionylleucylvalylseryltrypto… tylasparaginylglycylglycylserylprolyli… phylleucylglutamyllysylarginylglutamyl… ptophylserylarginylvalylserylarginylal… ylglycylleucyllysylglycylvalylglutamyl… rginylleucylleucylglutamylglycylvalyll… ginylalanylmethionylalanylisoleucylasp… glycylprolylprolylserylglutamylprolyls… ylglycylaspartylprolylisoleucylphenyla… serylcysteinylprolylglutamylvalyllysyl… lisoleucylserylleucylglycyltryptophyll… glycylglycylserylprolylisoleucyllysylg… ethionylglutaminylglutamylglutamylglyc… llysylarginylvalylasparaginylglutamylp… reonylthreonylcysteinylglutamylcystein… lysylglutamylleucylarginyllysyltyrosyl… lalanylvalylasparaginylglutamylalanylg… ylaspartylthreonylthreonylglycylglutam… rtylisoleucylglutaminylglutamylglutamy… leucylaspartylisoleucylglycylalanylglu… cysteinyllysylalanylglycylserylglutami… lanylvalylisoleucyllysylglycylarginylp… ryptophylglutamylphenylalanylaspartylg… hionyllysylaspartylglycylvalylhistidyl… rtylalanylglutaminylleucylglutamylthre… erylvalylisoleucylisoleucylisoleucylpr… rylhistidylthreonylglycyllysyltyrosyls… araginyllysylalanylglycylglutaminyllys… larginylvalyllysylvalylmethionylaspart… laspartylleucyllysylvalylserylaspartyl… cysteinylarginylleucylseryltryptophyll… aspartylglycylglycylaspartylarginyliso… cylglutamyllysylarginylthreonylisoleuc… ylthreonyllysylvalylasparaginylprolyla… threonylphenylalanylvalylvalylprolylas… aminylglutaminyltyrosylphenylalanylphe… lutamylasparaginylarginylphenylalanylg… ylglutamylthreonylisoleucylglutaminyla… aspartylprolylisoleucyltyrosylprolylpr… sylleucyllysylisoleucylglycylleucyliso… nylvalylhistidylleucylseryltryptophyll… artylglycylglycylserylprolylvalylthreo… tamylcysteinylleucylalanyltryptophylas… ysyllysylglutamylalanyltryptophylargin… ylarginylaspartylvalylglutamylglutamyl… lvalylglutamylaspartylleucylvalylgluta… mylphenylalanylarginylvalyllysylalanyl… alylseryllysylprolylserylalanylthreony… cysteinylglutaminylarginylprolylaspart… ylaspartylleucyllysylglutamylphenylala… utamylglycylthreonylasparaginylvalylas… soleucyllysylglycylvalylprolylphenylal… ptophylphenylalanyllysylalanylprolylpr… inyllysylglutamylprolylvalylleucyltyro… araginyllysylleucylvalylvalylaspartyla… cylvalylisoleucylprolylglutaminylseryl… glycylleucyltyrosylthreonylisoleucylth… inylleucylglycylthreonylalanylseryllys… araginylvalylleucylglycylarginylprolyl… isoleucyllysylphenylalanylglutamylsery… methionylthreonylleucylseryltryptophyl… ylaspartylglycylglycylseryllysylisoleu… soleucylglutamyllysylarginylglutamylal… tryptophylvalylhistidylvalylserylseryl… lthreonyltyrosylthreonylisoleucylproly… tidylglutamyltyrosylvalylphenylalanyla… minylasparaginyllysyltyrosylglycylisol… rtylserylglutamylprolylglutamylthreony… ylalanylserylvalylprolylglycylalanylpr… lserylserylvalylthreonylarginylasparag… raginyltryptophylglutamylglutamylproly… lserylprolylvalylthreonylglycyltyrosyl… sylaspartylthreonylthreonylseryllysyla… paraginylarginylaspartylprolylisoleucy… glycylvalylseryltyrosyllysylvalylthreo… cylserylaspartyltyrosylglutaminylpheny… leucylasparaginylalanylalanylglycylval… ylserylaspartylprolylalanylthreonylala… anylprolylprolylglycylprolylprolylphen… artyltryptophylthreonyllysylserylseryl… hylserylprolylprolylleucyllysylasparty… lglycyltyrosylisoleucylvalylglutamylty… ylglutamylglutamyltryptophylglutamylly… valylarginylglycylthreonyllysylleucylv… lutamylglycylalanylphenylalanyltyrosyl… lanylvalylasparaginylisoleucylalanylgl… ycylglutamylvalylthreonylaspartylvalyl… rtylarginylleucylvalylserylprolylaspar… anylserylvalylarginylaspartylarginylis… ylglycylvalylisoleucylarginylisoleucyl… cyllysylprolylprolylprolylthreonylvaly… onylasparaginylglutamylarginylthreonyl… lthreonylisoleucylglutamylthreonylthre… ethionylvalylisoleucyllysylasparaginyl… idylglutaminylglycylvalyltyrosylseryll… utamylalanylglycylglutamylarginyllysyl… laspartylvalylleucylaspartylvalylproly… lylphenylalanylleucylalanylhistidylasp… utamylserylcysteinyllysylleucylthreony… lutamylaspartylaspartylglycylglycylser… ltyrosylvalylisoleucylglutamyllysylarg… inylalanyltryptophylthreonylprolylvaly… ylarginylglutaminylasparaginylalanylth… oleucylglutaminylglycyllysylalanyltyro… soleucylalanylalanylglutamylasparaginy… lprolylphenylalanylvalylglutamylthreon… leucylarginylglutamylprolylisoleucylth… lylglutamylaspartylleucylglutamylvalyl… raginylthreonylvalylthreonylleucylthre… yllysyltyrosylaspartylglycylglycylsery… nyltyrosylvalylleucylglutamylserylargi… tamyllysylphenylalanylhistidyllysylval… ginylleucylleucylserylarginyllysyltyro… sylglutamylglycylaspartylthreonyltyros… lanylvalylasparaginylisoleucylvalylgly… phenylalanylcysteinylthreonyllysylprol… partylglutamylleucylalanylprolylprolyl… lphenylalanylarginylaspartyllysylleucy… lglutamylalanylphenylalanylalanylleucy… lycyllysylprolyllysylprolyllysylvalyls… rtylglutamylalanylaspartylvalylleucylg… nylhistidylisoleucyllysylthreonylthreo… leucylglutamyllysylisoleucyllysylalany… yllysyltyrosylcysteinylvalylvalylvalyl… cylserylarginyllysylglycylphenylalanyl… valylvalylaspartylhistidylprolylglycyl… erylphenylalanylaspartylglutamylvalylt… lvalylisoleucylseryltryptophyllysylpro… ylglycylseryllysylisoleucylthreonylasp… utamyllysyllysylglutamylvalylglycyllys… rolylvalylthreonylserylalanylserylalan… ylvalylseryllysylleucylleucylglutamylg… henylalanylarginylisoleucylhistidylala… glycylisoleucylserylaspartylprolylleuc… ysylalanyllysylaspartylarginylphenylal… lprolylaspartylglutaminylprolylisoleuc… llysylaspartylserylalanylleucylvalylth… lylhistidylaspartylglycylglycyllysylpr… osylisoleucylleucylglutamyllysylarginy… larginyltryptophylalanylarginylvalylth… istidylprolyltyrosylthreonyllysylpheny… ucylleucylglutamylglycylcysteinylgluta… inylvalylserylalanylglutamylasparaginy… ycylaspartylprolylserylprolylprolylser… llysylaspartylprolylisoleucylalanyllys… aginylprolylglutamylalanylisoleucylasp… aginylserylvalylaspartylleucylthreonyl… inylhistidylaspartylglycylglycylseryll… leucylvalylglutamyltyrosylglutaminylly… myltryptophylarginylarginylalanylaspar… lserylcysteinylprolylglutamylthreonyll… leucylarginylaspartylglycylglutaminylt… nylvalylleucylalanylvalylasparaginylal… ylprolylalanylhistidylvalylprolylgluta… tylarginylleucylglutamylprolylprolylgl… alanylasparaginylmethionylalanylarginy… llysylvalylglycylaspartylthreonylleucy… soleucyllysylglycylvalylprolylphenylal… hyllysyllysylglutamylaspartylarginylas… ylarginylisoleucylaspartylvalylthreony… lutamylisoleucylarginylasparaginylalan… cylglycylisoleucyltyrosylserylleucylth… lalanylglycylseryllysylthreonylvalylse… aspartyllysylprolylglycylprolylprolyla… rylglutamylisoleucylarginyllysylaspart… yltryptophyllysylglutamylprolylleucyla… ylisoleucylthreonylasparaginyltyrosylv… rtylvalylalanylserylalanylglutaminyltr… lthreonylseryllysyllysyllysylserylhist… leucylasparaginylglutamylglycylasparag… anylarginylvalylalanylalanylglutamylas… inylglycylprolylphenylalanylvalylgluta… yllysylalanylleucylaspartylprolylleucy… olyllysylaspartylleucylhistidylhistidy… eonylglutamylvalylserylleucylvalyltryp… larginylaspartylglycylglycylserylproly… ylvalylglutamyltyrosylglutaminylglutam… spartyltryptophylisoleucyllysylphenyla… raginylleucylglutamylcysteinylvalylval… taminylglycyllysylthreonyltyrosylargin… ylglutamylasparaginylisoleucylvalylgly… threonylthreonylisoleucylprolylisoleuc… yllysylleucylvalylprolylprolylserylval… eucylisoleucylglutamylglycylleucylvaly… onylvalylarginylphenylalanylprolylalan… lylprolylvalylprolylthreonylalanyllysy… glycylserylglutamylisoleucyllysylthreo… hreonylvalylglutamylthreonylaspartylas… lleucylthreonylisoleucyllysylasparagin… rtylthreonylglycylglutamyltyrosylgluta… araginylalanylalanylglycylseryllysylth… lthreonylvalylleucylaspartylvalylproly… olylisoleucylasparaginylisoleucylleucy… lhistidylmethionylthreonylisoleucylser… ysylaspartylaspartylglycylglycylserylp… ylisoleucylvalylglutamyllysylglutaminy… ylthreonyltryptophylglycylvalylvalylse… yllysylleucyllysylisoleucylprolylhisti… inylglutamyltyrosylvalylphenylalanylar… raginyllysylisoleucylglycylvalylglycyl… onylprolylthreonylvalylalanyllysylhist… lylserylprolylprolylglycyllysylprolylv… hreonylglutamylasparaginylalanylalanyl… lleucylprolyllysylserylaspartylglycylg… ycyltyrosyltyrosylmethionylglutamylarg… cyllysyltryptophylvalylarginylvalylasp… lalanylaspartylleucyllysylphenylalanyl… osylglutamylglycylasparaginylthreonylt… lylphenylalanylalanylglutamylasparagin… lprolylserylprolylserylserylaspartylpr… ginylprolylisoleucyllysylprolylprolylg… ylprolyllysylleucyllysylaspartyllysyls… partylleucylvalyltryptophylthreonyllys… ycylserylprolylisoleucylleucylglycylty… taminyllysylprolylglycylthreonylalanyl… nylisoleucylasparaginyllysylaspartylgl… nylcysteinylalanylphenylalanylarginylv… amylglycylasparaginylglutamyltyrosylar… sylalanylalanylasparaginylisoleucylval… larginylglutamylleucylalanylglutamylse… lisoleucylleucylhistidylprolylprolylgl… lylthreonylcysteinylarginylaspartylval… lglycylglutaminylthreonylisoleucylargi… llysylglycylarginylprolylglutamylproly… lthreonyllysylglutamylglycyllysylvalyl… nylvalylaspartylleucylisoleucylglutami… glutamylleucylglutaminylisoleucyllysyl… artylhistidylglycyllysyltyrosylisoleuc… nylserylserylglycylhistidylalanylgluta… lasparaginylvalylleucylaspartylarginyl… ylasparaginylleucyllysylvalylthreonyla… lasparaginylcysteinylthreonylisoleucyl… rolylleucylaspartylasparaginylglycylgl… sparaginylphenylalanylisoleucylvalylgl… raginylglutaminyllysylglycyltryptophyl… tylvalylthreonyllysylarginylleucylisol… ucylalanylasparaginylasparaginylglutam… valylcysteinylalanylglutamylasparaginy… hreonylisoleucylglutamylthreonyllysylt… soleucylasparaginylprolylisoleucylaspa… ylglutamylasparaginylleucylhistidyliso… lthreonylphenylalanylvalyltyrosylleucy… laspartyltyrosylaspartylglycylglycylse… sylhistidylvalylglutamylarginylarginyl… tyltryptophylglutamylarginylvalylhisti… utamylthreonylhistidyltyrosylmethionyl… lutamylasparaginylglutaminylisoleucylt… lylglutaminylthreonyllysylasparaginylg… artyltryptophylvalyllysylthreonylgluta… amylaspartylleucylglutaminyllysylproly… ylserylglycylvalylleucylthreonylvalyll… leucylarginylleucylglutamylalanylglycy… lalanylprolylglutamylvalylalanyltrypto… tylalanylthreonylaspartylleucylthreony… lisoleucylaspartylthreonylarginylalany… lserylleucylthreonyllysylalanyllysylar… tyrosylvalylvalylthreonylalanylthreony… ylphenylalanylvalylalanyltyrosylalanyl… aspartyllysylprolylglycylprolylvalylar… lvalylaspartylvalylserylserylaspartyla… yltryptophylaspartylprolylprolylglutam… inylglutamylisoleucylglutaminylasparag… ysylcysteinylglutamylthreonyllysylargi… eonyltyrosylserylalanylthreonylvalylle… eonylvalylthreonylarginylleucylisoleuc… tyrosylisoleucylphenylalanylarginylval… ysylisoleucylglycylthreonylglycylproly… olylvalylisoleucylalanyllysylthreonyll… larginylprolylaspartylprolylprolylglut… ylglutamylglutamylmethionylthreonylval… rolylglutamyltyrosylaspartylglycylglyc… tyrosylphenylalanylleucylglutamyllysyl… onylarginyltryptophylvalylprolylvalyla… prolylglutamylarginylarginylmethionyll… lleucylprolylaspartylhistidylglutamylt… valyllysylalanylglutamylasparaginylglu… glutamylprolylserylleucylprolylserylar… artylprolylisoleucylglutamylprolylprol… inylphenylalanylarginylvalylvalylaspar… ylisoleucylthreonylleucylglycyltryptop… artylglycylglycylalanylprolylisoleucyl… tamylmethionylarginylprolyllysylisoleu… spartylglutamylglycyltryptophyllysylar… ylalanylglutaminylleucylvalylarginylly… lthreonylserylleucylaspartylglutamylas… lutamylphenylalanylarginylvalylcystein… inylvalylglycylisoleucylglycylarginylp… mylalanylisoleucyllysylprolyllysylglut… olylglutamylisoleucylaspartylleucylasp… ylleucylvalylisoleucylvalylarginylalan… inylleucylphenylalanylalanylisoleucylv… lprolyllysylvalylthreonyltryptophylarg… ylasparaginylvalylvalylarginyllysylgly… ylaspartylthreonylmethionylalanylpheny… paraginylserylthreonylarginylaspartyla… leucylthreonylleucylvalylasparaginylpr… valylphenylalanylvalylasparaginylvalyl… rolylglycylprolylvalylserylaspartylleu… onyllysylthreonylserylcysteinylhistidy… olylglutamylasparaginylaspartylglycylg… stidyltyrosylisoleucylvalylglutamyllys… nyllysylthreonyltryptophylserylthreony… syllysylthreonylserylphenylalanylhisti… lylprolylglycylasparaginylglutamyltyro… hreonylalanylvalylasparaginylglutamylt… threonylaspartylvalylprolyllysylprolyl… lleucylserylglutamylprolylaspartylprol… lanylthreonylglutamylmethionylthreonyl… leucylalanyltryptophylleucylprolylprol… alanyllysylisoleucylaspartylglycyltyro… ginylglutamylglutamylglutamylglutaminy… hylthreonylglutamyltyrosylserylvalylva… lylvalylthreonylglycylleucyllysylgluta… ylalanylarginylvalylalanylalanylarginy… erylleucylprolylarginylglutamylalanylg… anyllysylglutamylglutaminylleucylleucy… thionylprolylglutamylglutaminylisoleuc… llysyllysylleucylarginylisoleucylgluta… lysylprolylhistidylprolylthreonylcyste… glutamylaspartylglutamylvalylvalylthre… alylhistidyllysylalanylaspartylserylse… leucyllysylaspartylvalylthreonylarginy… osylserylleucylthreonylalanylglutamyla… spartylthreonylglutaminyllysylisoleucy… tylalanylprolylglycylprolylprolylgluta… ylisoleucylserylaspartylisoleucylaspar… ylleucylseryltryptophylhistidylisoleuc… lglycylserylasparaginylisoleucylthreon… lutamyllysylcysteinylaspartylvalylsery… ylthreonylalanylleucylalanylserylvalyl… arginylvalylglycyllysylleucylisoleucyl… ylisoleucylphenylalanylarginylvalylarg… lphenylalanylglycylisoleucylserylgluta… ysylmethionylvalylalanylglutaminylphen… ylprolylserylglutamylprolyllysylaspara… lvalylasparaginyllysylaspartylcysteiny… yptophylaspartylarginylprolylaspartyls… isoleucylisoleucylglycyltyrosylleucyli… larginylasparaginylserylleucylleucyltr… aspartylthreonylleucylvalylarginylsery… inylalanylglycylleucylvalylglutamylgly… alanylarginylisoleucyltyrosylalanylleu… lserylprolylprolylseryllysylprolylthre… nylarginylmethionylprolylvalylaspartyl… ylvalylisoleucylaspartylvalylthreonyll… oleucyltryptophylalanylarginylprolylly… llysylisoleucylisoleucylglycyltyrosylp… inyllysylleucylprolylglycylaspartyllys… paraginylthreonylalanylprolylhistidylg… lutamylglutamyltyrosylthreonylalanylth… ysylalanylglutaminyltyrosylglutaminylp… anylarginylthreonylalanylvalylasparagi… lutamylprolylserylaspartylprolylvalylt… lasparaginylvalylprolylprolylarginylis… ylmethionyllysylserylleucylleucylthreo… paraginylvalylcysteinylleucylaspartyla… llysylprolylmethionylprolylthreonylval… glycylthreonylleucylleucyllysylprolyla… thionylalanylmethionylglutaminylarginy… leucylglutamylleucylphenylalanylserylv… serylglycylaspartyltyrosylthreonylisol… nylserylserylglycylseryllysylserylalan… valylleucylaspartyllysylprolylglycylpr… eucylasparaginyllysylmethionyltyrosyls… eucylseryltryptophylglutamylprolylprol… lserylglutamylisoleucylthreonylasparag… sylarginylglutamylthreonylserylarginyl… utaminylvalylserylalanylthreonylvalylp… lserylvalylglutamyllysylleucylisoleucy… sylglutaminylphenylalanylarginylisoleu… yllysyltyrosylglycylvalylglycylasparty… tamylprolylalanylisoleucylalanyllysyla… ylprolylglycylarginylcysteinylaspartyl… raginylisoleucylthreonyllysylaspartylh… ryptophyllysylprolylprolylalanylaspart… oleucylthreonylglycyltyrosylleucylleuc… nylglutaminylalanylvalylasparaginyltry… larginyllysylprolylisoleucylisoleucylg… anylthreonylglycylleucylglutaminylglut… utamylphenylalanylarginylvalylthreonyl… ylglycylprolylglycyllysylprolylserylas… yrosylalanylarginylaspartylprolylgluta… lprolylalanylphenylalanylprolyllysylva… rginylserylserylvalylserylleucylserylt… osylaspartylglycylglycylserylprolyliso… alylglutamylvalyllysylarginylalanylasp… phylvalylarginylcysteinylasparaginylle… ylglutaminyllysylthreonylarginylphenyl… ucylmethionylglutamylaspartylthreonylg… nylarginylvalyltyrosylalanylvalylaspar… rylaspartylprolylserylaspartylvalylpro… yllysylaspartylisoleucylleucylisoleucy… histidylaspartylalanylaspartylleucylar… ucylarginylalanylglycylvalylthreonylme… lylvalyllysylglycylarginylprolylprolyl… hylseryllysylprolylasparaginylvalylasp… lisoleucylglycylleucylaspartylisoleucy… anylaspartylthreonylphenylalanylleucyl… valylasparaginyllysyltyrosylaspartylal… ylthreonylleucylglutamylasparaginylser… tyrosylthreonylisoleucylvalylvalyllysy… lycylprolylprolylisoleucylasparaginylv… ucylseryllysylaspartylserylalanyltyros… olylprolylisoleucylisoleucylaspartylgl… ucylasparaginyltyrosylvalylvalylglutam… mylarginyllysylseryltryptophylserylthr… ysteinylseryllysylthreonylserylphenyla… eucylglutamylglutamylglycyllysylserylt… ylvalylphenylalanylalanylglutamylaspar… lglycylaspartylprolylglycylglutamylthr… lalanylserylglutaminylthreonylprolylgl… ysylvalylarginylserylvalylseryllysylse… yltryptophyllysyllysylprolylhistidylse… isoleucylisoleucylglycyltyrosylvalylva… ylglutamylglutamylasparaginyllysyltryp… yllysylserylleucylserylleucylglutaminy… cylthreonylglutamylglycyllysylglutamyl… alylserylalanylglutamylasparaginylglut… threonylprolylserylglutamylisoleucylth… ylaspartylvalylvalylalanylprolylaspart… ucylprolylaspartylleucylcysteinyltyros… nylserylasparaginylphenylalanylarginyl… lysylglycyllysylprolylalanylprolylsery… ylglutamylaspartylprolylleucylalanylth… erylvalylglutamylserylserylalanylvalyl… oleucylvalyltyrosylaspartylcysteinylgl… cyllysyltyrosylthreonylisoleucylthreon… glycylthreonyllysylglutamylglycylthreo… lvalylglycyllysylprolylglycylisoleucyl… lysylphenylalanylaspartylglutamylvalyl… ylthreonylleucyllysyltryptophylalanylp… cylglycylserylglutamylisoleucylthreony… lutamyllysylarginylaspartylserylvalyla… lvalylthreonylcysteinylalanylserylalan… nylphenylalanylarginylvalylthreonylarg… hionylglutamyltyrosylthreonylphenylala… sparaginyllysyltyrosylglycylvalylglycy… amylprolylisoleucylvalylalanylarginylh… lylprolylaspartylalanylprolylprolylpro… spartylvalylarginylhistidylaspartylser… lthreonylaspartylprolyllysyllysylthreo… threonylglycyltyrosylhistidylleucylglu… ylasparaginylserylleucylleucyltryptoph… lthreonylprolylisoleucylarginylmethion… alylthreonylglycylleucylthreonylglutam… ylphenylalanylarginylvalylmethionylala… glycylvalylglycyllysylprolylserylleucy… lalanylleucylaspartylprolylisoleucylas… glutamylvalylisoleucylasparaginylisole… valylthreonylleucylisoleucyltryptophyl… spartylglycylglycylhistidyllysylleucyl… glutamyllysylarginylaspartylleucylprol… llysylalanylasparaginylhistidylvalylas… ylalanylphenylalanylthreonylvalylthreo… lglycyllysyltyrosylglutamylphenylalany… asparaginylthreonylalanylglycylalanyli… mylserylthreonylglutamylthreonylisoleu… lutamyltyrosylglutamylalanylprolylthre… lylthreonylisoleucyllysylaspartylglycy… glycylaspartylthreonylisoleucylvalylle… isoleucylleucylglycyllysylprolylleucyl… llysylalanylglycyllysylaspartylisoleuc… ylthreonylglutaminylisoleucylthreonyls… lmethionylleucylthreonylisoleucyllysyl… partylalanylglycylglutamyltyrosylthreo… sparaginylprolylphenylalanylglycylthre… lysylvalylthreonylvalylleucylaspartylv… rolylvalylglutamylisoleucylserylaspara… lanylthreonylleucylthreonyltryptophylt… partylglycylglycylserylprolylisoleucyl… tamyllysylarginylglutamylthreonylseryl… ylvalylvalylserylglutamylaspartylisole… histidylvalylalanylthreonyllysylleucyl… lglutamyltyrosylisoleucylphenylalanyla… nylhistidyltyrosylglycyllysylglycylglu… amylprolylvalyllysylmethionylvalylaspa… prolylglycylprolylprolylglutamyllysylp… alylthreonyllysylasparaginylthreonylal… ylarginylprolylvalylaspartylaspartylgl… eonylglycyltyrosylhistidylvalylglutamy… rylleucylarginyltryptophylvalylarginyl… alylserylaspartylleucylarginylcysteiny… aminylglutamylglycylserylthreonyltyros… erylalanylglutamylasparaginylarginylal… ylserylglutamylalanylserylaspartylsery… lanylalanyltyrosylprolylprolylglycylpr… tidylvalylthreonylaspartylthreonylthre… lalanyltryptophylglycyllysylprolylhist… ylglutamylisoleucylthreonylglycyltyros… nyllysylvalylglycylaspartylglutamylala… threonylthreonylglycylthreonylalanylle… nylphenylalanylvalylvalylprolylasparty… myllysyltyrosylasparaginylphenylalanyl… lasparaginylaspartylalanylglycylvalylg… ucylprolylaspartylvalylglutamylisoleuc… onylalanylprolylaspartylphenylalanylgl… eucylarginylarginylthreonylleucylvalyl… isoleucylarginylisoleucylphenylalanylv… ylprolylalanylprolylglutamylvalylthreo… sparaginylisoleucylasparaginylleucylly… nylisoleucylglutamylasparaginylthreony… eucylleucylisoleucylisoleucylprolylglu… osylaspartylthreonylglycyllysylphenyla… lglutamylasparaginylprolylalanylglycyl… lylasparaginylvalylarginylvalylleucyla… lylleucylasparaginylleucylarginylproly… ysylaspartylserylvalylthreonylleucylhi… lleucylisoleucylaspartylglycylglycylse… nyltyrosylisoleucylvalylglutamyllysyla… lysylseryltyrosylserylthreonylalanylth… llysylcysteinylthreonyltyrosyllysylval… glycylcysteinylglutamyltyrosylphenylal… ylalanylglutamylasparaginylglutamyltyr… olylthreonylglutamylthreonylthreonylgl… utamylalanylprolylserylprolylprolylasp… lmethionylaspartylisoleucylthreonyllys… yltryptophylprolyllysylprolyllysylhist… soleucylthreonylglycyltyrosylvalylisol… llysylglycylserylaspartylglutaminyltry… eonylthreonylvalyllysylglycylleucylglu… raginylleucylthreonylglutamylglycylglu… lanylglutaminylvalylmethionylalanylval… ylserylalanylprolylarginylglutamylsery… sylglutamylglutaminylthreonylmethionyl… eucylarginylglycylisoleucyltyrosylglut… yllysylalanylglycylaspartylasparaginyl… lprolylvalylleucylglycylarginylprolyll… tophyllysyllysylglycylaspartylglutamin… eonylglutaminylarginylvalylasparaginyl… lalanylthreonylserylthreonylisoleucyll… lglutamylcysteinylvalylarginylserylasp… leucylthreonylalanylarginylasparaginyl… ycylaspartylvalylisoleucylthreonylisol… lisoleucylprolylglycylprolylprolylthre… lalanylaspartylglutamylvalylserylseryl… enylalanylseryltryptophylaspartylproly… lycylglycylvalylprolylisoleucylserylas… ethionylarginylglutaminylthreonylaspar… alylglutamylleucylalanylthreonylthreon… onyltyrosyllysylalanylthreonylarginyll… utamyltyrosylglutaminylphenylalanylarg… aginylarginyltyrosylglycylvalylglycylp… anyltryptophylisoleucylvalylalanylaspa… ylvalylprolylglycylprolylprolylglycylt… lalanylvalylthreonyllysylaspartylseryl… tophylhistidylglutamylprolylleucylsery… leucylleucylglycyltyrosylhistidylvalyl… asparaginylglycylisoleucylleucyltrypto… ylalanylleucylvalylprolylglycylasparag… serylglycylleucylthreonylaspartylglycy… ylalanylarginylvalylisoleucylalanylglu… yllysylseryllysylprolylseryllysylproly… alanylleucylaspartylprolylisoleucylasp… alylprolylleucylasparaginylisoleucylth… hreonylleucyllysyltryptophylalanyllysy… lglycylphenylalanyllysylisoleucylthreo… yllysylarginylaspartylleucylprolylaspa… llysylalanylasparaginylphenylalanylser… lasparaginylglutamylphenylalanylthreon… tamylaspartylalanylalanyltyrosylglutam… alanyllysylasparaginylalanylalanylglyc… erylglutamylprolylserylaspartylalanyli… artylaspartylvalylglutamylalanylprolyl… yllysylphenylalanyllysylaspartylthreon… ycylglutamylalanylphenylalanylarginyll… ylglycylarginylprolylprolylprolylthreo… lysylaspartylglycyllysylglutamylleucyl… ucylglutamylisoleucyllysylisoleucylala… lasparaginylleucylvalylasparaginyllysy… laspartylserylglycylalanyltyrosylthreo… raginylprolylglycylglycylphenylalanyla… anylasparaginylvalyllysylvalylleucylas… ylglutamylglycylprolylleucylalanylvaly… glutamyllysylcysteinylvalylleucylseryl… eucylaspartylaspartylglycylglycylalany… sylisoleucylvalylglutaminyllysylarginy… alanyltryptophylthreonylasparaginylval… lvalylthreonyllysylleucyllysylvalylthr… paraginylglutamyltyrosylisoleucylpheny… alylasparaginyllysyltyrosylglycylvalyl… erylglutamylprolylvalylleucylalanylval… lylprolylaspartylprolylprolyllysylaspa… hreonylisoleucylthreonyllysylaspartyls… ptophylglycylhistidylprolylaspartylser… isoleucylisoleucylasparaginyltyrosylis… spartyllysylalanylglycylglutaminylargi… lasparaginyllysyllysylthreonylleucylth… ysylvalylserylglycylleucylthreonylglut… utamylphenylalanylarginylisoleucylmeth… lalanylglycylisoleucylserylalanylproly… ylalanyltyrosyllysylalanylcysteinylasp… prolylglycylprolylprolylglycylasparagi… threonylserylarginylserylserylisoleucy… raginyllysylprolylisoleucyltyrosylaspa… cylthreonylglycyltyrosylmethionylvalyl… glutamylglutamylaspartylglutamyltrypto… lprolylprolylalanylglycylleucyllysylal… leucylthreonylglycylleucylthreonylglut… rosyllysylisoleucylarginylisoleucyltyr… glutamylglycylleucylglycylglutamylprol… onylprolyllysylalanylglutamylaspartyla… utamylisoleucylglutamylleucylaspartyla… lvalylthreonylisoleucylarginylalanylcy… ylleucylphenylalanylvalylprolylisoleuc… rolylglutamylvalyllysyltryptophylalany… mylserylleucylaspartyllysylalanylseryl… ryltyrosylthreonylleucylleucylisoleucy… inylarginylphenylalanylaspartylserylgl… onylvalylglutamylasparaginylserylseryl… anylvalylasparaginylvalylarginylvalyll… olylprolylglutaminylaspartylleucyllysy… ylthreonylserylvalylthreonylleucylthre… eucylleucylaspartylglycylglycylserylly… isoleucylvalylglutamyllysylarginylglut… tyrosylserylthreonylvalylalanylthreony… hreonylseryltryptophyllysylvalylaspart… lglycylcysteinylseryltyrosyltyrosylphe… utamylasparaginylglutamyltyrosylglycyl… utamylthreonylalanylglutamylserylvalyl… ylleucylprolylprolylglycyllysylisoleuc… lylthreonylarginylasparaginylserylvaly… lysylprolylglutamylhistidylaspartylgly… lglycyltyrosylisoleucylvalylglutamylme… lserylaspartyllysyltryptophylalanylthr… sylvalylthreonylglutamylalanylthreonyl… cylglutaminylglycylglutamylglutamyltyr… rylalanylglutaminylasparaginylglutamyl… olylarginylglutaminylleucylserylvalylp… tylleucylvalylisoleucylprolylprolylala… nylalanylasparaginylthreonylphenylalan… utamylaspartylleucyllysylvalylaspartyl… cylarginylprolylthreonylprolylalanylva… spartylasparaginylvalylprolylleucyllys… valylasparaginylalanylglutamylserylthr… serylleucylleucylthreonylisoleucyllysy… amylaspartylvalylglycylhistidyltyrosyl… ginylserylalanylglycylglutamylalanylis… ginylvalylisoleucylvalylleucylaspartyl… ylglycylprolylvalyllysylmethionylaspar… tylserylisoleucylthreonylleucylseryltr… sylaspartylglycylglycylserylserylisole… oleucylvalylglutamyllysylarginylaspart… onyltryptophylglutaminylisoleucylvalyl… ylthreonylthreonylisoleucyllysylalanyl… glycylcysteinylglutamyltyrosylglutamin… lalanylglutamylasparaginylarginyltyros… ucylasparaginylserylglutamylprolylthre… lylphenylalanyllysylvalylprolylglycylp… lvalylthreonylleucylserylserylarginyla… lutaminyltryptophylasparaginylglutamyl… lycylserylarginylvalylisoleucylglycylt… lysylglutamylarginylasparaginylserylis… ucylasparaginyllysylthreonylprolylisol… henylalanyllysylthreonylthreonylglycyl… utamyltyrosylglutamylphenylalanylargin… ylisoleucylvalylglycylisoleucylglycyll… mylcysteinyltyrosylvalylalanylarginyla… lprolylglycylarginylprolylglutamylalan… ginylasparaginylserylvalylthreonylleuc… lylthreonyltyrosylaspartylglycylglycyl… rosylisoleucylvalylglutamyllysyllysylg… ginyltryptophylmethionyllysylalanylser… oleucylisoleucylaspartylthreonylhistid… glycylleucylvalylglutamylaspartylhisti… ylarginylvalylisoleucylalanylarginylas… nylalanylserylglutamylprolylserylgluta… ylthreonylalanylarginylaspartylglutamy… oleucylserylmethionylaspartylprolyllys… ucylvalylvalylhistidylalanylglycylglut… rtylalanylaspartylisoleucyltyrosylglyc… lisoleucylglutaminyltryptophylisoleucy… mylleucylserylasparaginylthreonylalany… lserylthreonylaspartylphenylalanylalan… laspartylalanylvalylarginylvalylaspart… eucylleucyllysylalanyllysylasparaginyl… ylvalylthreonylvalylasparaginylvalylly… glycylprolylprolylglutamylglycylprolyl… threonylalanylglutamyllysylcysteinylth… olylprolylleucylglutaminylaspartylglyc… ucylasparaginyltyrosylisoleucylvalylgl… lserylarginylleucylvalyltryptophylthre… inylvalylglutaminylthreonylleucylseryl… cylleucylglutamylglycylasparaginylglut… nylisoleucylmethionylalanylvalylaspara… lutamylprolylleucylglutamylserylglutam… ginylprolylphenylalanylvalylvalylproly… lylglutamylvalylthreonylthreonylvalylt… soleucylvalylvalyltryptophylglutamylar… lglycylserylglutamylisoleucylleucylgly… rginylaspartyllysylglutamylglycylisole… lcysteinylhistidyllysylarginylleucylis… eucylarginylvalylthreonylglycylleucyli… aspartyltyrosylglutamylphenylalanylarg… inylalanylalanylglycylleucylserylgluta… yltyrosylglutaminyllysylalanylcysteiny… lprolylglycylprolylprolylasparaginylas… spartylisoleucylthreonylarginylserylse… tophylseryllysylprolylisoleucyltyrosyl… ylisoleucylglutaminylglycyltyrosylisol… artylvalylasparaginylvalylglycylglutam… nylthreonylprolylprolylthreonylglycyli… araginylisoleucylglutamylvalylglutamyl… dylglutamyltyrosylasparaginylphenylala… soleucylasparaginyllysylalanylglycylva… rtylvalylprolylglycylprolylisoleucylis… ucylglutamylalanylprolylaspartylisoleu… amylleucylarginyllysylisoleucylisoleuc… glycylglycylserylleucylarginylleucylph… glycylarginylprolylthreonylprolylgluta… alylaspartylglycylglutamylisoleucylarg… oleucylaspartylvalylthreonylserylseryl… lleucylaspartylasparaginylvalylasparag… yllysyltyrosylthreonylleucylthreonylle… ycylthreonyllysylserylalanylphenylalan… cylaspartylthreonylprolylserylprolylpr… lthreonylglutamylisoleucylthreonyllysy… reonyltryptophylglutamylprolylprolylle… lysylisoleucyllysylasparaginyltyrosyli… utamylalanylthreonylarginyllysylserylt… lasparaginylcysteinylhistidyllysylaspa… laspartylglutaminylleucylglutaminylglu… osylphenylalanylarginylvalylthreonylal… sylglycylisoleucylglycylleucylprolylal… lprolylisoleucyllysylvalylalanylglutam… glycyllysylisoleucylthreonylvalylaspar… raginylserylvalylserylleucylseryltrypt… tidylaspartylglycylglycylseryllysyliso… leucylvalylglutamylmethionylglutaminyl… yltryptophylserylglutamylcysteinylalan… minylalanylvalylisoleucylthreonylaspar… lglutamylglutamyltyrosylleucylphenylal… araginylglutamyllysylglycylarginylsery… anylvalylprolylisoleucylvalylalanyllys… mylprolylaspartylvalyllysylprolylalany… valylglutaminylvalylglycylglutaminylas… alylprolylisoleucylserylglycylarginylp… reonyltryptophylthreonyllysylaspartylg… nylthreonylthreonylarginylisoleucylasp… eucylaspartylleucylthreonylthreonylleu… nylhistidyllysylaspartylaspartylglycyl… cylthreonylvalylalanylasparaginylvalyl… lanylserylisoleucylglutamylisoleucylva… laspartylprolylprolyllysylglycylprolyl… tylvalylserylalanylglutamylserylisoleu… araginylprolylprolylleucyltyrosylthreo… soleucylthreonylasparaginyltyrosylisol… artylthreonylthreonylthreonylthreonylv… ylalanylthreonylvalylalanylarginylthre… llysylleucyllysylthreonylglycylthreony… nylarginylisoleucylphenylalanylalanylg… cylglutaminylserylphenylalanylalanylle… eucylvalylalanylglutaminyltyrosylproly… olylprolylglycylthreonylprolylphenylal… ryllysylaspartylserylmethionylvalyliso… lutamylprolylvalylasparaginylasparagin… ucylglycyltyrosylhistidylleucylglutamy… inylserylisoleucylleucyltryptophylthre… nylisoleucylisoleucylhistidylaspartylt… lanylglutaminylasparaginylleucylglutam… rosylglutamylphenylalanylarginylvalylt… eucylvalylglycylvalylglycyllysylalanyl… ysteinyltyrosylvalylalanylarginylaspar… lylglycylthreonylprolylglutamylprolyli… sparaginylglutamylisoleucylthreonylleu… lprolylvalyltyrosylaspartylglycylglycy… cyltyrosylisoleucylvalylglutamyllysyla… lycylarginyltryptophylmethionyllysylal… ginylvalylisoleucylglutamylthreonylglu… ylglycylleucylthreonylglutamylaspartyl… nylalanylarginylvalylisoleucylalanylly… nylisoleucylseryllysylprolylserylaspar… ylthreonylalanyllysylaspartylglutamylv… eucylserylmethionylaspartylprolyllysyl… isoleucylvalylvalylasparaginylalanylgl… inylleucylglutamylalanylaspartylvalylh… lthreonylisoleucylglutamyltryptophylle… mylisoleucylglutamylglutamylserylalany… ysylasparaginylthreonylaspartylphenyla… ylvalyllysylaspartylalanylisoleucylarg… utaminyltyrosylisoleucylleucylarginyla… cylseryllysylserylphenylalanylprolylva… aspartylarginylprolylglycylprolylproly… lvalylthreonylglycylvalylthreonylseryl… reonyltryptophylserylprolylprolylleucy… laspartylisoleucylserylhistidyltyrosyl… mylthreonylserylarginylleucylalanyltry… lglutamylvalylvalylthreonylasparaginyl… eucylleucylglutamylglycylasparaginylgl… ylisoleucylmethionylalanylvalylasparag… utamylprolylleucylglutamylserylalanylp… aginylprolylphenylalanylvalylleucylpro… ylglutamylvalylthreonylasparaginylisol… nylthreonylvalylcysteinyltryptophylasp… spartylglycylglycylserylglutamylisoleu… alylglutamyllysylarginylaspartylarginy… hylisoleucyllysylcysteinylasparaginyll… aspartylleucylarginylleucylarginylvaly… ylaspartylhistidylglutamyltyrosylgluta… nylglutamylasparaginylalanylalanylglyc… lylalanylthreonylvalyltyrosyltyrosylly… ylphenylalanyllysylprolylglycylprolylp… dylisoleucylvalylaspartylthreonylthreo… reonylleucylalanyltryptophylglycyllysy… ylglycylserylglutamylisoleucylleucylgl… cylcysteinyllysylalanylaspartylglutamy… ylisoleucylvalylthreonylprolylglutamin… hreonylarginylphenylalanylglutamylisol… ylhistidylglutaminylglutamyltyrosyllys… nylleucylasparaginyllysylvalylglycylle… ylvalylprolylglycylthreonylvalyllysylp… tamylalanylprolylglutamylleucylasparty… rginyllysylglycylisoleucylvalylvalylar… rginylisoleucylhistidylisoleucylprolyl… lmethionylprolylglutamylisoleucylthreo… utamylglycylglutamylphenylalanylthreon… ucylglutamyllysylglycylvalylasparaginy… ylisoleucylaspartylasparaginylcysteiny… alanylglycyllysyltyrosylisoleucylleucy… lserylglycylseryllysylserylalanylpheny… leucylaspartylthreonylprolylglycylprol… alanylvalyllysylglutamylvalylarginylly… eucylvalyltryptophylglutamylprolylprol… lycylalanyllysylvalyllysylasparaginylt… ginylglutamylserylthreonylarginyllysyl… serylseryllysylcysteinylseryllysylthre… amylasparaginylleucylthreonylglutamylg… henylalanylarginylvalylmethionylalanyl… anylglycylvalylglycylvalylprolylvalylg… alyllysylalanylalanylglutamylprolylpro… lthreonylleucylthreonylaspartylvalylse… ylleucylmethionyltryptophylglutamyllys… cylglycylserylarginylvalylleucylglycyl… lutaminylprolyllysylglycylthreonylglut… lylalanylglutamylseryllysylvalylcystei… nylglycylleucylserylserylglycylglutami… lanylarginylvalyllysylalanyltyrosylasp… ylaspartylprolylarginylvalylleucylglyc… sylaspartylleucylthreonylisoleucylglut… rolylphenylalanylasparaginylthreonylty… glycylglutamylaspartylleucyllysylisole… leucylglycylarginylprolylarginylprolyl… valyllysylaspartylglycylglutamylprolyl… ylarginylvalylasparaginylvalylglutamyl… threonylvalylleucylhistidylisoleucylly… partylaspartylphenylalanylglycyllysylt… reonylasparaginylserylalanylglycylthre… ylleucylserylvalylisoleucylvalylleucyl… ylvalylglycylprolylvalylarginylphenyla… ylaspartylphenylalanylvalylvalylisoleu… lylalanyltyrosylthreonylglycylglycylcy… raginyltyrosylisoleucylvalylglutamylly… hreonylthreonylthreonyltryptophylhisti… lvalylalanylarginylthreonylthreonyliso… ucyllysylthreonylglycylthreonylglutamy… ylisoleucylphenylalanylalanylglutamyla… serylalanylprolylleucylaspartylserylly… nyltyrosylprolylphenylalanyllysylgluta… reonylprolylphenylalanylvalylthreonyls… aminylmethionylleucylvalylglutaminyltr… asparaginylaspartylglycylglycylthreony… ylhistidylleucylglutamylglutaminyllysy… ucylleucyltryptophylvalyllysylleucylas… ylglutaminylaspartylthreonyllysylpheny… eucylaspartylglutamylglycylleucylgluta… valylserylalanylglutamylasparaginyliso… ylprolylseryllysylvalylserylglutamylcy… ylaspartylprolylcysteinylaspartylproly… lanylisoleucylvalylisoleucylthreonylar… eonylleucyllysyltryptophyllysyllysylpr… ylseryllysylisoleucylthreonylglycyltyr… laspartylleucylprolylaspartylglycylarg… erylphenylalanylthreonylasparaginylval… nylalanylthreonylvalylserylglycylleucy… inyltyrosylglutamylphenylalanylarginyl… nylalanylalanylglycylasparaginylphenyl… tylserylserylglycylalanylisoleucylthre… oleucylaspartylalanylprolylasparaginyl… ltyrosyllysylaspartylvalylisoleucylval… threonylphenylalanylvalylleucylglutamy… yllysylprolylisoleucylprolylaspartylva… lglycyllysylglutamylleucylglutamylglut… ionylglutamylisoleucyllysylserylthreon… hreonylleucylvalylvalyllysylaspartylcy… rtylglycylglycylglutaminyltyrosylisole… ylvalylglycylglycylthreonyllysylseryli… llysylvalylleucylaspartylarginylprolyl… ylleucyllysylvalylthreonylglycylvalylt… tyrosylleucylalanyltryptophylasparagin… tylglycylglycylalanylasparaginylisoleu… leucylglutamyllysylarginylglutamylthre… ylthreonylglutaminylvalylserylthreonyl… asparaginyltyrosyllysylvalylthreonylly… nylglutamyltyrosylisoleucylphenylalany… paraginyllysyltyrosylglycylisoleucylgl… ylglycylprolylvalylthreonylalanylcyste… olylprolylglycylprolylprolylserylthreo… oleucylthreonyllysylaspartylserylmethi… nylarginylprolylvalylaspartylaspartylg… lglutamylglycyltyrosylisoleucylleucylg… tamylglycylvalylarginyltryptophylthreo… sylthreonylleucylthreonylaspartylleucy… lycylleucylthreonylglutamylglycylhisti… arginylvalylalanylalanylglutamylaspara… lutamylprolylserylglutamylprolylserylv… lcysteinylaspartylalanylleucyltyrosylp… sparaginylprolyllysylvalylthreonylaspa… alylserylleucylalanyltryptophylserylly… ycylglycylalanylprolylvalyllysylglycyl… glutamylalanylalanylalanylaspartylglut… inylthreonylprolylprolylthreonylglycyl… ylphenylalanylthreonylvalylthreonyllys… eonylglutamyltyrosylasparaginylphenyla… lisoleucylasparaginylserylglutamylglyc… reonylleucylprolylglycylserylvalylvaly… leucylglutamylprolylprolylglutamylisol… partylleucylarginyllysylvalylvalylvaly… onylleucylarginylleucylphenylalanylval… ylprolylglutamylprolylglutamylvalyllys… amylglycylisoleucylleucylthreonylaspar… glutamylvalylthreonylserylserylphenyla… oleucylaspartylasparaginylvalylthreony… ycylarginyltyrosylasparaginylleucylthr… aginylserylglycylseryllysylthreonylala… larginylvalylleucylaspartylserylprolyl… ucylthreonylisoleucylarginylglutamylva… onylleucylseryltryptophylglutamylproly… lglycylalanyllysylisoleucylthreonylasp… yllysylarginylglutamylthreonylthreonyl… onylisoleucylthreonylasparaginylaspara… threonylphenylalanylarginylisoleucylgl… utamylglycylcysteinylseryltyrosyltyros… nylserylasparaginylglutamyltyrosylglyc… glutamylthreonylthreonylglutamylprolyl… rolylleucylprolylprolylglycylarginylva… threonylarginylasparaginylthreonylalan… lutamyllysylprolylglutamylserylasparty… eonylglycyltyrosylvalylvalylglutamylme… lserylglutamyllysyltryptophylserylthre… llysylthreonylleucylglutamylalanylthre… nylalanylglycylglutamylglutamyltyrosyl… alanylvalylasparaginylglutamyllysylgly… lglutaminylleucylglycylvalylprolylvaly… eucylglutamylisoleucyllysylprolylseryl… ylhistidylthreonylphenylalanylasparagi… lutaminylleucyllysylisoleucylaspartylv… ginylprolylglutaminylalanylthreonylval… aspartylglycylglutaminylthreonylleucyl… lvalylasparaginylvalylserylserylseryll… lserylisoleucyllysylglutamylalanylsery… reonyltyrosylglutamylleucylcysteinylva… lserylisoleucylthreonylvalylprolylisol… lleucylaspartylarginylprolylglycylprol… lisoleucylaspartylglutamylvalylserylcy… ylisoleucylseryltryptophylasparaginylp… lycylglycylcysteinylglutaminylisoleucy… lylglutamyllysyllysylglutamylthreonylt… hylhistidylisoleucylvalylserylglutamin… erylisoleucyllysylisoleucylvalylarginy… lutamyltyrosylglutaminylphenylalanylar… paraginylarginyltyrosylglycyllysylsery… lalanylvalylvalylalanylglutamyltyrosyl… glycylprolylprolylglycylthreonylprolyl… yllysylserylthreonylmethionylleucylval… prolylvalylasparaginylaspartylglycylgl… ltyrosylhistidylleucylglutamyltyrosyll… cylleucyltryptophylseryllysylalanylasp… ylalanylaspartylthreonylglutaminylvaly… lglutamylglycylleucylmethionyltyrosylg… anylglutamylasparaginylisoleucylalanyl… seryllysylserylcysteinylglutamylprolyl… lylcysteinylaspartylprolylprolylglycyl… ylasparaginylisoleucylthreonylarginyll… ophylseryllysylprolylhistidyltyrosylas… cylthreonylglycyltyrosylisoleucylvalyl… lprolylaspartylglycylarginyltryptophyl… sylthreonylasparaginylisoleucylglutami… nylglutamylvalylthreonylglutamylleucyl… rginyltyrosylglutamylphenylalanylargin… araginylalanylalanylaspartylserylvalyl… ylthreonylglycylprolylisoleucylisoleuc… utamylprolylprolylarginylvalylmethiony… lanylarginylaspartylvalylisoleucylvaly… lleucyllysylisoleucylasparaginylalanyl… lprolylleucylprolylvalylisoleucylseryl… isoleucylglutamylisoleucylglutamylglut… tamylisoleucylisoleucylserylthreonylas… ucylleucylthreonylvalyllysylaspartylcy… tylthreonylglycylglutaminyltyrosylvaly… ylvalylalanylglycylthreonylarginylsery… yllysylvalylleucylaspartyllysylprolylg… leucylglutamylisoleucylasparaginylglyc… cysteinylserylleucylseryltryptophylgly… spartylglycylglycylalanylaspartylisole… rginyllysyllysylarginylglutamylthreony… lthreonylisoleucylcysteinylglutamylgly… lthreonylserylcysteinyllysylvalylthreo… raginylglutamyltyrosylisoleucylphenyla… lasparaginyllysyltyrosylglycylvalylgly… lvalylalanylisoleucyllysylalanylleucyl… alylprolylserylprolylprolylthreonylser… rylvalylthreonyllysylglutamylserylmeth… hylserylarginylprolylglutamylserylaspa… cylserylglycyltyrosylisoleucylisoleucy… lasparaginylserylleucylarginyltryptoph… lysylprolylvalyltyrosylaspartylleucyla… leucylarginylglutamylglycylcysteinylgl… valyltyrosylalanylglutamylasparaginyla… rolylserylglutamylthreonylserylprolyll… aspartylprolylvalylphenylalanylleucylp… lyllysylisoleucylvalylaspartylserylgly… reonylisoleucylalanyltryptophylvalylly… glycylglycylalanylprolylisoleucylthreo… yltyrosyllysyllysylserylaspartylaspart… reonylserylisoleucylglutaminylserylleu… osylthreonylisoleucylserylglycylleucyl… ltyrosylvalylphenylalanylarginylvalyll… glycylalanylserylaspartylprolylserylas… minylisoleucylalanyllysylglutamylargin… cylphenylalanylaspartylisoleucylaspart… lthreonylleucylisoleucylvalyllysylalan… onylmethionylthreonylvalylprolylphenyl… ylprolylasparaginylvalylleucyltryptoph… spartylleucylarginylthreonylarginylala… onylaspartylserylarginylthreonylseryll… aginylalanylasparaginylarginylasparagi… hreonylleucylthreonylisoleucylglutamin… alanylserylleucylthreonylleucylvalylva… prolylglycylprolylprolylthreonylaspara… ylaspartylvalylthreonyllysylglutamylse… aspartylvalylprolylglutamylasparaginyl… yllysylasparaginyltyrosylhistidylisole… nylseryllysyllysylalanyltryptophylvaly… aginylcysteinylasparaginylarginylleucy… raginylleucylglutaminylglutamylglycyla… lanylarginylvalylserylglycylglutamylas… valylglycylisoleucylprolylalanylglutam… ysylisoleucylthreonylglutamyllysylprol… cylglycylvalylthreonylserylisoleucylse… ylthreonyltryptophylleucyllysylprolylg… serylarginylisoleucylvalylhistidyltyro… utamyllysylglycylglutaminyllysylaspara… lanylvalylalanyllysylserylthreonylhist… ucylarginylglutamylasparaginylserylglu… larginylvalylphenylalanylalanylglutamy… eucylserylaspartylprolylarginylglutamy… lisoleucyllysylglutamylglutaminylleucy… cylaspartylmethionyllysylasparaginylph… ylvalyltyrosylvalylarginylalanylglycyl… artylisoleucylprolylisoleucylserylglyc… threonylleucylserylarginylaspartylglyc… nylmethionylarginylphenylalanylasparag… ylalanylglutamylasparaginylleucylthreo… lutamylserylvalylthreonylalanylasparty… isoleucylthreonylalanylalanylasparagin… ysylalanylphenylalanylisoleucylasparag… ylarginylprolylglycylprolylprolylthreo… erylaspartylisoleucylthreonylglutamylg… ltryptophylglutamylprolylprolyllysylty… minylvalylthreonylasparaginyltyrosylis… amylthreonylserylthreonylalanylvalyltr… lanylthreonylvalylalanylarginylthreony… nyllysylleucylthreonylthreonylglycylgl… ylalanylarginylisoleucyllysylalanylglu… glycylisoleucylserylaspartylhistidylis… valylthreonylvalyllysylleucylprolyltyr… lylprolylserylthreonylprolyltryptophyl… ylarginylglutamylserylisoleucylthreony… mylprolylvalylserylasparaginylglycylgl… sylhistidylleucylglutamylmethionyllysy… leucylleucyltryptophylglutaminyllysyla… leucylarginylthreonylthreonylhistidylp… ylisoleucylserylalanylglycylleucylisol… inylvalyltyrosylalanylglutamylasparagi… ylprolylserylhistidylprolylserylglutam… spartylalanylcysteinylglutamylprolylpr… soleucylthreonylaspartylisoleucylseryl… ylseryltryptophylglutaminylglutaminylp… ylglycylseryllysylisoleucylthreonylgly… inylarginylaspartylleucylprolylasparty… ylalanylserylphenylalanylthreonylaspar… glutaminylphenylalanylthreonylisoleucy… lasparaginylserylglutaminyltyrosylglut… lanylalanylarginylasparaginylalanylval… nylprolylserylglutamylvalylvalylglycyl… leucylaspartylseryltyrosylglycylglycyl… rolylleucylglutamyltyrosylthreonylglut… anylglycylthreonylserylvalyllysylleucy… lycyllysylprolylalanylprolylthreonylis… ylaspartylaspartyllysylglutamylleucylg… eucylvalylcysteinylvalylglutamylaspara… alanylserylisoleucylleucylisoleucyllys… ylasparaginylserylglycylcysteinyltyros… sparaginylalanylmethionylalanylserylal… inylvalylglutaminylisoleucylleucylaspa… ycylglycylprolylisoleucylglutamylpheny… anylglutamyllysylisoleucylthreonylleuc… ylalanylaspartylaspartylglycylglycylal… yrosylisoleucylvalylglutamyllysylargin… valyltryptophylserylmethionylvalylsery… amylcysteinylisoleucylisoleucylthreony… eucyllysylglycylasparaginylglutamyltyr… ylarginylalanylvalylasparaginyllysylty… rolylleucylglutamylserylaspartylserylv… ylphenylalanylvalylthreonylprolylglycy… lutamylvalylthreonyllysylisoleucylthre… hreonylvalylvalyltryptophylserylarginy… lglycylserylaspartylisoleucylserylglyc… lysylarginylaspartyllysyllysylserylleu… lvalylleucyllysylglutamylthreonylisole… lutaminyllysylvalylthreonylglycylleucy… partyltyrosylglutaminyltyrosylarginylv… alanylalanylglycylglutaminylglycylprol… rylglutamylphenylalanyltyrosyllysylala… artylprolylprolylglycylprolylprolylala… anylaspartylserylthreonyllysylserylser… tophylseryllysylprolylvalyltyrosylaspa… eonylglycyltyrosylvalylvalylglutamylis… mylglutamylglutamylglutamyltryptophylt… sylglycylglutamylvalylarginylthreonylt… ylasparaginylleucyllysylprolylglycylva… lanylarginylvalylserylalanylvalylaspar… ylglycylglutamylprolylisoleucylglutamy… valylglutaminylalanyllysylaspartylisol… amylisoleucylaspartylleucylaspartylval… alylisoleucylalanyllysylalanylglycylgl… eucylisoleucylprolylphenylalanyllysylg… nylvalylthreonyltryptophylarginyllysyl… cylglycylserylaspartylalanylarginyltyr… ylthreonylaspartylserylserylserylleucy… minylvalylthreonylarginylasparaginylas… leucylleucylthreonylisoleucylglutamyla… prolyllysylserylserylthreonylvalylsery… nylprolylalanylalanylcysteinylglutamin… stidylvalylserylarginylglycylthreonylv… spartylprolylprolylleucylisoleucylaspa… lisoleucylasparaginyltyrosylvalylisole… nylthreonyllysylarginylthreonyltryptop… lcysteinylserylserylthreonylserylpheny… leucylserylglutamyllysylthreonylprolyl… larginylvalylleucylalanylglutamylaspar… cylglycylglutamylprolylcysteinylglutam… yllysylalanylalanylglutamylvalylprolyl… lleucylserylmethionyllysylaspartylsery… leucylleucylseryltryptophylthreonyllys… lglycylglycylserylvalylisoleucylthreon… arginyllysylglycyllysylglycylglutamylg… tidylalanylglycylisoleucylseryllysylth… tamylvalylserylglutaminylleucyllysylgl… tamylphenylalanylarginylvalylphenylala… sylglycylleucylserylaspartylprolylvaly… ucylthreonylvalyllysylglutamylleucylis… mylvalylaspartylleucylserylaspartyliso… alylthreonylvalylarginylisoleucylglycy… ucylglutamylleucylprolyltyrosyllysylgl… eucylseryltryptophylleucyllysylasparty… mylserylglutamylphenylalanylvalylargin… tamylasparaginyllysylisoleucylthreonyl… lalanyllysyllysylglutamylhistidylglycy… leucylleucylaspartylasparaginylalanylv… valylprolylisoleucylthreonylvalylisole… lseryllysylprolyllysylglycylprolylisol… tamylisoleucyllysylalanylaspartylseryl… aspartylvalylprolylglutamylaspartylasp… soleucylthreonylcysteinyltyrosylseryli… lthreonylserylglutaminylthreonylaspara… ysteinylserylserylvalylalanylarginylth… lprolylasparaginylleucylvalyllysylaspa… phenylalanylarginylvalylarginylalanylg… cylvalylserylglutaminylprolylleucylval… alanyllysylhistidylglutaminylphenylala… ylprolylglycyllysylprolylvalylisoleucy… ylaspartylglycylmethionylserylleucylth… lvalyltyrosylaspartylglycylglycylseryl… anylhistidylvalylglutamyllysyllysylglu… ylleucyltryptophylglutaminyllysylvalyl… ucylserylglycylarginylglutamyltyrosyla… ylglutamylglycylleucylaspartyltyrosylg… rosylalanylglutamylasparaginylserylala… laspartylprolylseryllysylphenylalanylt… valylaspartylprolylprolylglycylthreony… rtylvalylthreonylarginylglutamylthreon… ophylasparaginylprolylprolylleucylargi… oleucylvalylglycyltyrosylserylisoleucy… ylasparaginylglutamylarginyltryptophyl… nylalanylthreonylaspartylvalylserylglu… onylvalylthreonylglycylleucylserylprol… mylphenylalanylarginylisoleucylisoleuc… ylglycylthreonylisoleucylserylprolylpr… isoleucylisoleucylmethionylthreonylarg… lprolylprolylisoleucylvalylglutamylphe… lphenylalanylaspartylglycylleucylisole… ylserylleucylarginylisoleucyllysylalan… lprolylvalylprolylarginylvalylthreonyl… glycylvalylglutamylisoleucylglutamylly… onylglutamylisoleucylthreonylasparagin… ylleucylphenylalanylvalylarginylaspart… idylarginylglycylvalyltyrosylthreonylv… lanylserylglycylserylalanyllysylalanyl… ylglutaminylaspartylthreonylprolylglyc… cylarginylphenylalanylthreonylasparagi… ysylmethionylthreonylleucyltryptophylt… asparaginylaspartylglycylcysteinylalan… rosylisoleucylisoleucylglutamyllysylar… ucylalanyltryptophylalanylleucylisoleu… utamylalanylglutaminylseryltyrosylthre… ucylasparaginylglycylasparaginylglutam… nylvalylserylalanylvalylasparaginyllys… nylprolylleucylaspartylserylaspartylpr… ucylglutaminyltyrosylthreonylvalylprol… ylprolylglutamylprolylserylasparaginyl… erylisoleucylthreonylleucylthreonyltry… erylaspartylglycylglycylserylglutamyli… isoleucylleucylglutamylarginylarginylg… yltryptophylvalyllysylvalylisoleucylse… glutamylthreonylarginylphenylalanyllys… glutamylglycylasparaginylglutamyltyros… methionylalanylglutamylasparaginylalan… ylserylglycylisoleucylserylarginylleuc… tamylprolylvalylasparaginylprolylproly… yllysylvalylthreonylaspartylthreonylse… eucylglutamyltryptophylseryllysylproly… cylmethionylglutamylisoleucylisoleucyl… amylmethionylcysteinyllysylthreonylasp… histidyllysylvalylasparaginylalanylglu… nylarginyltyrosylthreonylvalylthreonyl… lglutamylglutamyltyrosyllysylphenylala… asparaginylglycylalanylglycyllysylglyc… ylthreonylglycylthreonylisoleucyllysyl… eonylalanylprolylglutamylleucylasparty… phenylalanyllysylglutaminylthreonylhis… lanylserylisoleucylarginylleucylphenyl… nylglycylarginylprolylthreonylprolylth… ylprolylaspartylserylasparaginylleucyl… leucylhistidylthreonylthreonylaspartyl… lthreonylvalylglutamylasparaginylcyste… partylalanylglycyllysyltyrosylthreonyl… nylasparaginylserylglycylseryllysylser… onylvalyllysylvalylleucylaspartylthreo… olylisoleucylthreonylphenylalanyllysyl… erylalanylthreonylleucylmethionyltrypt… ylaspartylglycylglycylalanylarginyliso… alylglutamyllysylarginylglutamylalanyl… lutaminylvalylisoleucylserylglutamylly… ylisoleucylphenylalanyllysylvalylaspar… lycylvalylprolyltyrosyltyrosylphenylal… araginylglutamyltyrosylglycylvalylglyc… ionylprolylglutamylprolylisoleucylvaly… olylalanylprolylprolylarginylarginylle… nylseryllysylserylserylalanylvalylleuc… aspartylhistidylaspartylglycylglycylse… rosylleucylleucylglutamylmethionylargi… ylleucyltryptophylvalylglutamylalanylg… lleucylthreonylphenylalanylthreonylval… llysylthreonylglutamyltyrosylglutamylp… ysylasparaginylaspartylalanylglycyltyr… mylalanylphenylalanylserylserylvalylis… glutaminylisoleucylglutamylprolylthreo… ylisoleucylthreonylasparaginylglutamin… ysylalanylglycylserylprolylphenylalany… ylisoleucylserylglycylarginylprolylala… yllysylleucylglutamylglutamylmethionyl… spartylarginylvalylserylisoleucylthreo… inylthreonylthreonylleucylthreonylvaly… glycylaspartylserylglycylarginyltyrosy… utamylasparaginylthreonylalanylglycylv… alylthreonylvalylvalylvalylisoleucylgl… hreonylglycylprolylisoleucylglutamylva… ylserylcysteinylvalylleucylseryltrypto… ylglycylglycylglycylthreonylglutamylis… oleucylvalylglutamyllysylarginylglutam… tryptophylglutaminylleucylvalylasparag… onylglutaminylisoleucyllysylvalylthreo… ylmethionylglutamyltyrosylserylphenyla… asparaginylarginylphenylalanylglycylva… rylalanylprolylisoleucylisoleucylalany… valylprolylprolylserylalanylprolylthre… ylhistidylvalylserylalanylasparaginyla… tryptophylglutamylglutamylprolyltyrosy… ysylisoleucylisoleucylglycyltyrosyltry… mylarginylasparaginylthreonylisoleucyl… sparaginyllysylvalylprolylcysteinylleu… syllysylvalylthreonylglycylleucylvalyl… glutaminylphenylalanylarginylthreonylt… alanylglycylvalylseryllysylalanylseryl… leucylmethionylalanylglutaminylasparag… glycylarginylprolylglutamylvalylthreon… threonylvalylserylleucylisoleucyltrypt… aspartylglycylglycylseryllysylvalylval… utamylarginyllysylprolylvalylserylglut… ltryptophylleucyllysylcysteinylasparag… rylaspartylasparaginylphenylalanylphen… leucylserylglutamylglycylaspartylthreo… ylvalylleucylalanyllysylasparaginylala… ysylglycylserylglutamylserylthreonylgl… inylaspartylglutamyltyrosylalanylproly… artylalanylarginylleucylhistidylglycyl… larginylalanylglycylserylaspartylleucy… ylglycylglycyllysylprolylglutamylproly… hreonyllysylglycylaspartyllysylglutamy… myllysylvalylserylleucylglutaminyltyro… threonylalanylvalylisoleucyllysylpheny… laspartylserylglycyllysyltyrosylthreon… ylalanylserylglycylthreonyllysylalanyl… alylleucylaspartylserylprolylglycylpro… ylvalylserylarginylvalylthreonylglutam… eucylalanyltryptophylserylleucylprolyl… cylalanylglutamylisoleucylthreonylhist… ginylarginylglutamylthreonylserylargin… soleucylvalylglutamylglycylglutamylcys… sylvalylvalylthreonylarginylleucylisol… tamyltyrosylisoleucylphenylalanylargin… llysyltyrosylglycylprolylglycylvalylpr… lisoleucylvalylalanylarginylasparaginy… prolylserylprolylprolylglycylisoleucyl… reonylglycyllysylglutamylhistidylisole… ptophylthreonyllysylprolylglutamylsery… tamylisoleucylserylasparaginyltyrosyll… myllysylglutamylserylleucylarginyltryp… yllysylaspartyltyrosylvalylvalyltyrosy… valylthreonylserylleucylmethionylgluta… utaminylphenylalanylarginylvalylthreon… lglycylasparaginylserylglutamylprolyls… phenylalanylisoleucylserylcysteinylarg… nylprolylglycylprolylprolylserylalanyl… onylthreonyllysylhistidylserylisoleucy… llysylprolylmethionyltyrosylaspartylgl… valylglycyltyrosylvalylleucylglutamylm… rtylthreonylaspartylglutaminyltryptoph… ylasparaginylalanylthreonylisoleucylar… nylalanylthreonylvalylprolylaspartylle… ysyltyrosylserylphenylalanylarginylval… lysylglycylmethionylserylglutamyltyros… glutamylisoleucylglutamylprolylvalylgl… ucylprolylaspartylleucylglutamylleucyl… sylthreonylvalylthreonylisoleucylargin… nylleucylmethionylvalylserylvalylseryl… lisoleucylthreonyltryptophylseryllysyl… ucylalanylserylarginylalanylisoleucyli… tamylseryltyrosylserylleucylleucylisol… inylarginyltyrosylaspartylalanylglycyl… ylalanylglutamylasparaginylglutaminyls… onylvalylleucylvalyllysylvalyltyrosyla… steinylprolylserylvalyllysylvalyllysyl… rylvalylthreonylisoleucylthreonyltrypt… lisoleucylaspartylglycylglycylalanylpr… tyrosylisoleucylvalylglutamyllysylargi… inylalanylphenylalanyllysylthreonylval… yllysylthreonylleucyltyrosylarginyliso… lglycylthreonylmethionylhistidyltyrosy… ylglutamylasparaginylisoleucyltyrosylg… ysteinylglutamylthreonylserylaspartyla… alylprolylleucylvalylprolylalanyllysyl… ylthreonyllysylserylthreonylvalylthreo… sylprolylleucyltyrosylaspartylglycylgl… ltyrosylvalylleucylglutamylalanylcyste… ylarginyltryptophylmethionyllysylvalyl… nylvalylleucylglutamylhistidylthreonyl… glutamylglycylglutamylglutaminyltyrosy… arginylalanylglutaminylasparaginylglut… olylarginylglutamylthreonylvalylthreon… laspartylleucylarginylvalylleucylproly… ylthreonylmethionylprolylglutaminyllys… lylalanylglycylarginylprolylvalylgluta… cylalanylglycylarginylprolylprolylprol… alanylphenylalanylalanylglycylseryllys… larginylvalylthreonylvalylglutamylthre… llysylleucylthreonylisoleucylarginylgl… nylaspartylthreonylglycylglutamyltyros… asparaginylvalylthreonylglycylthreonyl… cyllysylvalylisoleucylisoleucylleucyla… lthreonylglycylprolylisoleucyllysyliso… rtylalanylthreonylserylisoleucylthreon… rolylprolylglutamylleucylaspartylglycy… ltyrosylvalylvalylglutamylglutaminylar… rolylglycyltryptophylleucylprolylvalyl… nylserylthreonylphenylalanyllysylpheny… lglutamylglycylasparaginylglutamyltyro… nylalanylthreonylasparaginylarginylphe… tyrosylleucylglutaminylserylglutamylva… lserylserylisoleucylarginylisoleucylpr… nylleucylglutaminylisoleucylphenylalan… glycylmethionylthreonylleucylthreonylt… laspartylaspartylglycylglycylserylglut… leucylvalylglutamylarginyllysylglutamy… ryptophylvalylarginylvalylasparaginyll… ylthreonylarginyltyrosylarginylserylth… lycylleucylglutamyltyrosylglutamylhist… ucylasparaginylalanylarginylglycylsery… lseryllysylprolylisoleucylvalylalanylm… ylprolylprolylglycyllysylprolylglutami… eonylaspartylthreonylthreonylarginylth… yptophylserylvalylprolylglutamylaspart… ylthreonylglycyltyrosylleucylisoleucyl… ylaspartylglutaminylhistidylglutamyltr… aginylthreonylthreonylprolylthreonylly… hreonylleucylthreonylhistidylleucylpro… rosylarginylphenylalanylarginylvalylle… lglycylglycylprolylglycylglutamylproly… eonylvalyllysylvalylthreonylglutamylme… spartyltyrosylglutamylleucylaspartylgl… mylglycylisoleucylphenylalanylvalylarg… eucylarginylleucylthreonylisoleucylpro… henylalanylprolylisoleucylcysteinyllys… ycylglutaminylaspartylisoleucylserylly… lanylthreonylserylglutamylthreonylhist… eucyllysylglutamylalanylaspartylarginy… yrosylaspartylleucylvalylleucylglutamy… yllysylalanylvalyltyrosylisoleucyllysy… rylprolylasparaginylserylprolylglutamy… spartylaspartylisoleucylglutaminylvaly… tryptophylarginylprolylprolylalanylasp… rtylisoleucylleucylglycyltyrosylisoleu… amylvalylprolyllysylalanylalanyltrypto… lserylarginylvalylarginylglycylthreony… ucyllysylglutamylasparaginylvalylgluta… ylvalylserylalanylglutamylasparaginylg… lseryllysylprolylleucyllysylserylgluta… llysylthreonylprolylleucylasparaginylp… lasparaginylprolylprolylglutamylvalyll… lserylvalylserylleucylseryltryptophyls… tylglycylglycylserylarginylvalylthreon… amylarginyllysylglutamylthreonylserylt… ylhistidylasparaginyllysylthreonylglut… onylmethionyltyrosylthreonylvalylthreo… lanylglutamyltyrosylglutaminylphenylal… glutaminylasparaginylaspartylvalylglyc… rolylalanylserylglutamylprolylvalylval… lalanylaspartyllysylprolylserylglutami… ylisoleucylleucylserylisoleucylserylly… glutaminyltryptophylglutamyllysylproly… cyllysylglutamylisoleucylleucylglycylt… larginylglutaminylserylglycylaspartyls… asparaginyllysylglutamylarginylisoleuc… lalanylthreonylisoleucylglycylglycylle… tamyltyrosylglutamylphenylalanylarginy… araginylglutamylthreonylglycylleucylse… nylalanylmethionylserylisoleucyllysylt… ylglutamylalanylprolylglycylisoleucyla… partylvalylthreonylthreonyllysylleucyl… lleucylserylcysteinylglutaminylisoleuc… lylaspartylisoleucyllysyltryptophyltyr… lutamylleucylisoleucylglutaminylseryla… ylserylaspartylglycylarginylthreonylhi… thionylthreonylglutamylglutamylglutami… lyltyrosylthreonylcysteinylisoleucylal… lglycylglutamylvalylglutamylthreonylse… aminylalanylthreonylprolylglutaminylph… ylprolylleucyllysylglutamyllysyltyrosy… lthreonylleucylarginylleucylhistidylva… rginylprolylvalylprolylalanylmethionyl… dylglycylglutaminyllysylleucylleucylgl… araginylisoleucylthreonylisoleucylglut… idyltyrosylthreonylhistidylleucylvalyl… minylarginyllysylthreonylhistidylalany… inylleucylserylasparaginylvalylphenyla… nylisoleucylleucylaspartylvalylglutamy… olylaspartyllysylprolylthreonylglycylp… lalanylleucylleucyllysylasparaginylser… yllysylprolylprolylalanylaspartylaspar… ucylthreonylasparaginyltyrosylvalylval… nyllysylglutamylglycylalanylglutamyltr… erylalanylisoleucylserylvalylthreonylt… ylasparaginylleucylthreonylglutamylasp… henylalanylarginylvalylserylalanylglut… ylglycylisoleucylserylaspartylprolylle… ylisoleucylisoleucyllysylserylprolylph… alanylprolylglycyllysylprolylthreonyli… lysylaspartylserylcysteinylvalylvalyla… nylserylaspartylglycylglycylalanyllysy… tyrosylleucylglutamyllysylarginylgluta… ysyltryptophylisoleucylserylvalylthreo… larginylglutamylthreonylvalylphenylala… isoleucylglutamylglycylleucylglutamylt… lyllysylcysteinylglutamylasparaginylle… yltryptophylserylglutamylisoleucylsery… lyllysylserylaspartylvalylprolylisoleu… enylalanyllysylglutamylglutamylleucyla… alylarginyltyrosylglutaminylserylaspar… einyllysylvalylthreonylglycylhistidylp… tryptophyltyrosylarginylglutaminylglyc… anylaspartylglycylleucyllysyltyrosylar… nylalanyllysylglycylglycyltyrosylhisti… ylalanylserylvalylthreonylaspartylaspa… sylglutaminylvalylarginylalanylthreony… erylvalylserylglycylthreonylalanylsery… olylalanyllysylisoleucylhistidylleucyl… ycylmethionylglycylalanylvalylhistidyl… lylvalylserylisoleucyllysylisoleucylpr… lylaspartylprolylvalylisoleucylthreony… taminylaspartylleucylisoleucylaspartyl… ltyrosylglutaminylvalylisoleucylvalylt… onylserylleucylvalylphenylalanylprolyl… yllysylaspartylalanylglycylphenylalany… sylasparaginylarginylphenylalanylglycy… reonylvalylglutamylleucylaspartylvalyl… olylprolylarginylglycylvalyllysylvalyl… rtylserylvalylasparaginylleucylthreony… anylserylaspartylglycylglycylseryllysy… lisoleucylvalylglutamyllysylcysteinyla… arginyltryptophylleucylarginylvalylgly… hreonylarginyltyrosylthreonylvalylisol… lycyllysylthreonylseryltyrosylglutamin… alanylglutamylasparaginyllysylphenylal… ylglutamylprolylserylglutamylprolylthr… aspartyllysylthreonylarginylalanylmeth… amylglutamylvalylaspartylglutamylthreo… ylthreonyllysylalanylserylhistidylsery… rosylglutamyllysyltyrosylmethionylisol… ycylarginylglycylglutamylphenylalanylg… ysteinylvalylglutamylthreonylserylsery… alanyllysylphenylalanylvalyllysylvalyl… ylvalylleucylvalyllysyllysylglutamylis… nylisoleucylalanylarginylhistidylargin… lleucylhistidylglutamylserylphenylalan… tamylleucylvalylmethionylisoleucylphen… ylserylglycylleucylaspartylisoleucylph… sparaginylthreonylserylalanylphenylala… larginylglutamylisoleucylvalylseryltyr… teinylglutamylalanylleucylglutaminylph… ylasparaginylisoleucylglycylhistidylph… rolylglutamylasparaginylisoleucylisole… larginylserylserylthreonylisoleucyllys… lanylglycylglutaminylalanylarginylglut… ylasparaginylphenylalanylarginylleucyl… lylglutamyltyrosyltyrosylalanylprolylg… dylaspartylvalylvalylserylthreonylalan… ylserylleucylglycylthreonylleucylvalyl… isoleucylasparaginylprolylphenylalanyl… inylglutaminylglutaminylisoleucylisole… hionylasparaginylalanylglutamyltyrosyl… lglutamylalanylphenylalanyllysylglutam… anylmethionylaspartylphenylalanylvalyl… ylglutamylarginyllysylserylarginylmeth… nylleucylglutaminylhistidylprolyltrypt… eucylglutamylarginylvalylserylthreonyl… eucyllysylhistidylarginylarginyltyrosy… ucyllysyllysylaspartylleucylasparaginy… ylarginylisoleucylserylcysteinylglycyl… utaminyllysylglycylvalylserylvalylalan… oleucylglutamylisoleucylglycylprolylva… thionylhistidylalanylvalylglycylglutam… lysyltyrosylvalylcysteinyllysylisoleuc… lglutaminylserylthreonylglutaminylvaly… nylglycylvalylarginylglutaminylleucylg… ltyrosylglutamylisoleucylthreonyltyros… isoleucylleucyltyrosylvalyllysylaspart… tylaspartylglycylthreonyltyrosylarginy… laspartyltyrosylglycylglutamylaspartyl… ylphenylalanylvalyllysylglycylvalylarg… osyltyrosylcysteinylarginylarginylthre… ylarginylarginylthreonylaspartylthreon… mylarginylprolylprolylglutamylphenylal… ylasparaginyllysylthreonylalanyltyrosy… larginylphenylalanylglycylvalylthreony… ylglutamylprolylhistidylvalylthreonylt… taminyllysylisoleucyllysylprolylglycyl… yltyrosylthreonylphenylalanylglutamyls… lglutaminylleucylthreonylisoleucylaspa… partylaspartylaspartylalanylglutamylty… lasparaginyllysyltyrosylglycylglutamyl… sylleucylthreonylvalylthreonylleucylhi… artylserylthreonylleucylarginylprolylm… cylleucylalanylasparaginylalanylglutam… glutaminylserylvalylcysteinylphenylala… ylglycylisoleucylprolylprolylprolylthr… ysylaspartylglycylglutaminylprolylleuc… lisoleucylglutamylisoleucylisoleucylhi… yrosyltyrosylalanylleucylhistidylisole… olylglutamylaspartylthreonylglycyltyro… lthreonylasparaginylthreonylalanylglyc… inylalanylhistidylleucylglutaminylvaly… llysyllysylglutaminylglutamylphenylala… istidylglutamylarginylhistidylvalylglu… rtyllysylthreonylleucylarginylmethiony… glycylthreonylglutamylserylvalylprolyl… lysylglutamylalanylleucylarginylglutam… ylprolylalanylvalylserylthreonyllysylt… ylalanylarginylleucylglutamylisoleucyl… lutamylarginyllysylleucylarginylmethio… glutamylprolylarginyllysyltyrosyllysyl… glutamylglutamylaspartylglutaminylargi… anylvalylprolylmethionylserylaspartylm… lysylisoleucylarginylaspartylglutaminy… yllysylleucylaspartylarginylvalylvalyl… ginylisoleucylarginylleucylserylarginy… alanyltyrosylvalylmethionylprolylleucy… rtylglutaminyltyrosylarginylprolyllysy… sylleucylserylglutaminylaspartylaspart… ylprolylalanylarginylarginylarginylthr… ylaspartylphenylalanyltyrosyltyrosylar… ylleucylglycylaspartylisoleucylserylas… eucylprolylisoleucylaspartylaspartylty… nylthreonylglutamylglutamylglutamylarg… amylglutamylleucylglutamylleucylglycyl… rolylserylarginylserylprolylprolylhist… serylleucylarginyltyrosylserylserylpro… ylvalylglutamylglutamylthreonylarginyl… tyrosylserylthreonyltyrosylhistidyliso… amylalanylserylthreonylseryltyrosylala… inylhistidylalanylglutaminylalanylalan… ylglutaminylarginylglutaminylarginylis… ylglutamylaspartylglutamylglutamylleuc… hreonylthreonylglutaminylhistidylleucy… amylleucylaspartylphenylalanylmethiony… ylarginyllysyllysylserylarginylarginyl… nylglutamylisoleucylthreonylglutamylis… sylglutamylisoleucylseryllysylhistidyl… lserylserylserylalanylserylarginylleuc… lserylleucylserylprolylthreonyltyrosyl… inylprolylvalylserylglutamylleucylisol… minylprolylalanylglutamylglutamyltyros… lutamylarginylarginylserylprolylthreon… nylprolylarginylserylprolylserylprolyl… leucylserylarginylphenylalanylglutamyl… ylaspartylisoleucylphenylalanylserylar… ysylalanylalanylleucyllysylthreonylglu… ginyllysyltyrosylglutamylvalylleucylse… alanylthreonylleucylaspartylhistidylal… eucylarginylmethionylarginylserylhisti… lglutaminylasparaginylthreonylarginylp… ylvalylglutaminylseryllysylprolylthreo… yltyrosylhistidylasparaginylglycylvaly… rylseryllysylisoleucylhistidyltyrosylt… ylvalylleucylthreonylleucylglutamyliso… ylthreonylaspartylaspartylserylglycylt… teinylthreonylasparaginyltyrosyllysylg… osylalanylthreonylleucylaspartylvalylt… hreonylthreonyltyrosylalanylserylgluta… glutamylvalylprolylarginylserylvalylph… nylarginylthreonylglutamylalanyltyrosy… lysyllysylthreonylserylglutamylmethion… larginylglutamylvalyllysylserylglutami… larginylglutamylserylleucylserylserylt… rylalanylglutamylmethionyllysylserylal… ylserylleucylglutamylglutamyllysylsery… cyllysylthreonylthreonylleucylalanylal… ysylprolylarginylserylmethionylthreony… serylalanylarginylphenylalanylserylcys… lglutamylprolylvalylprolylthreonylvaly… ylglycylglutaminylvalylleucylserylthre… minylvalylthreonylthreonylthreonyllysy… nylglutamylisoleucylserylserylvalylglu… lycylasparaginyltyrosylserylvalylvalyl… ylglycyllysylglutaminylglutamylalanylg… reonylisoleucylglutaminyllysylalanylar… ylvalylthreonylserylprolylprolylarginy… larginylvalyllysylserylprolylglutamyla… nylvalyllysylserylprolylglutamylprolyl… serylprolylthreonylglutamylthreonyllys… yllysylvalylglutaminylhistidylleucylpr… ylisoleucylthreonylglutaminylphenylala… eryllysylglutamylisoleucylalanyllysyll… tamylserylserylvalylleucylarginylalany… yltyrosyllysylaspartylglycyllysyllysyl… lhistidylphenylalanylglutaminylphenyla… rtylglycylthreonyltyrosylglutamylleucy… ylleucylthreonylglutamylserylaspartylg… cysteinylglutamylisoleucylserylglycylg… ylthreonylasparaginylleucylglutaminylp… lalanylphenylalanyllysylserylisoleucyl… lisoleucylserylglutamylthreonyllysylly… onylthreonylglutamylserylthreonylvalyl… lprolyllysylalanylprolylglutamylprolyl… isoleucylvalylthreonylglycylleucylglut… serylserylaspartylserylvalylalanyllysy… threonylglycylglutamylprolylarginylpro… lthreonyllysylaspartylglycyllysylalany… lycyllysyltyrosyllysylleucylserylgluta… lanylphenylalanylleucylglutamylisoleuc… onylserylaspartylserylglycylleucyltyro… sylasparaginylserylalanylglycylserylva… cylthreonylisoleucyllysylalanylisoleuc… ylglutaminyllysylvalylserylthreonylglu… oleucylthreonylprolylglutaminyllysylly… ylglutamylisoleucylserylglutaminyllysy… utamylisoleucyllysylmethionylserylglut… myllysylleucylalanylleucyllysylglutamy… lisoleucylserylglutamylglutamylvalylly… rylleucylglutamyllysylserylisoleucylva… lthreonyllysylthreonylserylglutaminyla… nylthreonylhistidylalanylglutamylisole… eonylglutaminylmethionylserylisoleucyl… arginylleucylvalylleucyllysylalanylasp… threonylaspartylvalyllysyltryptophylva… amylleucylthreonylasparaginylserylglut… ycylvalylserylglycylserylaspartylgluta… llysylglutaminylalanylserylhistidylarg… leucylthreonylcysteinylisoleucylseryll… eucylvalyllysylcysteinylglutaminyltyro… llysylglutamylleucylserylaspartylalany… erylglutaminylprolylarginylserylglutam… glutamylglycylglutaminylasparaginylval… ylglutamylisoleucylserylglycylglutamyl… lutamyltryptophylphenylalanyllysylaspa… ucylserylisoleucylserylserylasparaginy… ylarginylasparaginylvalyltyrosylseryll… ginylalanylserylvalylserylaspartylsery… llysylalanyllysylasparaginylphenylalan… erylalanylthreonylalanylserylleucylmet… lutamylglutamylprolylserylarginylgluta… erylglycylaspartylthreonylserylleucylg… ylserylglutaminylserylvalylglutaminylm… inylglutamylalanylserylphenylalanylser… erylalanylserylserylmethionylthreonylg… anylserylmethionylserylalanylglutaminy… lutaminylglutamylserylphenylalanylvaly… rylphenylalanylmethionylglycylisoleucy… lutaminylleucylglutamylserylserylthreo… anylglycylisoleucylarginylglycylisoleu… ylalanylleucylprolylserylaspartylisole… lycyllysylvalylleucylthreonylvalylalan… ylglycylglutamylprolylthreonylprolylgl… ysteinylglycylglycylarginyllysylisoleu… lutaminylglycylarginylphenylalanylhist… eonylaspartylaspartylleucylthreonylthr… nylaspartylvalylglutaminyllysylglutami… lthreonylleucylserylleucylglycylaspara… laspartylserylalanylthreonylvalylaspar… inylserylisoleucine




Tên full của protein đây:
Full chemical name of titin 

Methionylthreonylthreonylglutaminylala…
ylglutaminylprolylleucylglutaminylsery…
lserylthreonylalanylthreonylphenylalan…
rylglycylphenylalanylprolylvalylprolyl…
lanylarginylaspartylglycylglutaminylva…
nylleucylprolylglycylvalylglutaminylis…
ylglycylarginylalanyllysylleucylthreon…
llysylalanylasparaginylserylglycylargi…
eonylasparaginylglycylserylglycylgluta…
nylglutamylleucylleucylvalyllysylalany…
asparaginylphenylalanylvalylglutaminyl…
ylthreonylvalylarginylglutaminylglycyl…
utaminylvalylarginylvalylthreonylglycy…
lylvalyllysylphenylalanyltyrosylarginy…
cylglutaminylserylserylleucylaspartylp…
glutaminylglutamylglycylaspartylleucyl…
anylglutamylalanyltyrosylprolylglutamy…
serylvalylasparaginylalanylthreonylasp…
ylthreonylserylthreonylalanylglutamyll…
tamylglutamylglutamylvalylprolylalanyl…
eucylvalylserylthreonylalanylglutaminy…
glutaminylthreonylarginylisoleucylglut…
ylhistidylphenylalanylaspartylalanylar…
lylglutamylmethionylvalylisoleucylaspa…
nylglutaminylleucylprolylhistidyllysyl…
lprolylprolyllysylprolyllysylserylargi…
erylisoleucylalanylalanyllysylalanylgl…
ylglutaminylserylprolylserylprolylisol…
lprolylvalylarginylhistidylvalylarginy…
lylvalylarginylserylvalylserylprolylal…
onylserylprolylisoleucylarginylserylva…
thionylarginyllysylthreonylglutaminyla…
ylglycylprolylglutamylvalylprolylproly…
tamylglycyltyrosylvalylalanylserylsery…
ylarginylglutamylthreonylthreonylleucy…
minylisoleucylarginylthreonylglutamylg…
cylarginyltyrosylglycylvalylglutaminyl…
eucylserylglycylalanylalanylglycylalan…
serylalanylseryltyrosylalanylalanylglu…
lalanyllysylglutamylvalyllysylglutamin…
lanylalanylvalylalanylthreonylvalylval…
lalanylarginylvalylarginylglutamylprol…
tamylglutaminylthreonylalanylglutaminy…
eonylalanylvalylhistidylisoleucylgluta…
glutaminylvalylarginyllysylglutamylala…
threonyllysylvalylvalylvalylalanylalan…
lutaminylglutamylleucyllysylserylargin…
leucylthreonylthreonyllysylglutaminylg…
alylthreonylhistidylglutamylglutaminyl…
ylglutamyllysylthreonylphenylalanylval…
ylalanylalanyllysylalanyllysylglutamyl…
oleucylserylglutamylglutamylisoleucylt…
taminylvalylthreonylglutaminylglutamyl…
ylthreonylarginyllysylthreonylvalylval…
nylthreonylprolyllysylvalyllysylglutam…
larginylglycylarginylglutamylglycyliso…
lutamylglutaminylvalylglutaminylisoleu…
ethionylarginyllysylglutamylalanylglut…
hreonylisoleucylalanylvalylalanylthreo…
utaminylglutamylthreonylisoleucylleucy…
onylmethionylalanylthreonylarginylglut…
utaminylvalylthreonylhistidylglycyllys…
lalanylglutamylalanylvalylalanylthreon…
ylglutaminylalanylarginylvalylarginylg…
lycylhistidylleucylglutamylglutamylser…
threonylthreonylleucylglutamyltyrosylg…
leucylserylalanylalanyllysylvalylalany…
nylprolylalanylserylglutamylprolylhist…
llysylprolylarginylvalylisoleucylgluta…
nylhistidylisoleucyllysylthreonylthreo…
hionylhistidylisoleucylserylserylgluta…
eonylaspartylleucylthreonylthreonylglu…
laspartyllysylarginylprolylarginylthre…
alanylthreonylvalylseryllysylisoleucyl…
ylhistidylglycyltyrosylglutamylalanyls…
lisoleucylalanylthreonylleucylglutamin…
eonylserylserylalanylglutaminyllysylis…
alanylprolylthreonylvalyllysylprolylse…
nylalanylglutamylprolylthreonylprolyll…
olylphenylalanylalanylaspartylthreonyl…
erylglutamylalanylglycylvalylglutamylv…
lylserylisoleucylthreonylglycylthreony…
ylarginylphenylalanylglutamylvalylleuc…
yllysylvalylthreonylglutamylthreonylal…
alylglutamylisoleucylprolylvalylthreon…
rylglycylleucyllysylasparaginylvalylth…
lutamylserylvalylthreonylleucylglutamy…
cyltyrosylprolylserylprolylthreonylval…
lutamylaspartyltyrosylglutaminylisoleu…
tylphenylalanylglutaminylisoleucylthre…
ylisoleucylalanylarginylleucylmethiony…
ylalanylalanylglutamylaspartylserylgly…
inylserylalanylvalylasparaginylglutamy…
onylserylcysteinyltyrosylleucylalanylv…
tamylphenylalanylglutamyllysylglutamyl…
glutamyllysylphenylalanylthreonylthreo…
ylalanylvalylglutamylserylarginylaspar…
tylthreonylserylleucylthreonylglutamyl…
lglycylglutamylprolylalanylalanylproly…
yllysylprolylvalylvalylglutaminyllysyl…
lvalylvalylphenylalanylglycylcysteinyl…
nylprolyllysylprolylhistidylvalyltyros…
lylprolylleucylthreonylthreonylglycylt…
tyrosylasparaginyllysylglutaminylthreo…
ylvalylisoleucylserylmethionylthreonyl…
lanylglycylglutamyltyrosylthreonylisol…
sylhistidylglycylglutamylthreonylseryl…
lutamylglutamylalanylaspartyltyrosylgl…
ylglutaminylglutaminylglutamylmethiony…
taminylvalylthreonylalanylphenylalanyl…
ylvalylglycylglutamylthreonylalanylpro…
rylglutamyltyrosylglutamyllysylglutamy…
inylalanylleucylisoleucylarginyllysyll…
eonylvalylvalylvalylarginylthreonyltyr…
glutamylphenylalanylhistidylisoleucyls…
ylarginylleucylisoleucyllysylglutamyli…
ucylisoleucyllysylthreonylthreonylleuc…
mylglutamylaspartylglycylglutamylgluta…
lisoleucylserylglutamylserylglutamylal…
lanylaspartylleucylarginylisoleucyllys…
lleucylglutamylglycylmethionylglycylva…
einyllysylmethionylserylglycyltyrosylp…
yltryptophyltyrosyllysylaspartylglycyl…
lycylglutamylarginyltyrosylglutaminylm…
lutaminylaspartylglycylarginylalanylse…
lvalylleucylprolylglutamylaspartylglut…
lanylphenylalanylalanylserylasparaginy…
nylisoleucylcysteinylserylglycyllysyll…
ylalanylprolylleucylglycylalanylprolyl…
nylleucylglutamylprolylvalylserylargin…
rolylarginylserylvalylserylarginylsery…
ylprolylalanylarginylmethionylserylpro…
lalanylarginylmethionylserylprolylalan…
arginylarginylleucylglutamylglutamylth…
ylleucylglutamylarginylleucyltyrosylly…
yllysylprolylvalylserylphenylalanyllys…
ylasparaginylcysteinylarginylphenylala…
cylarginylprolylmethionylprolylglutamy…
ylalanylhistidylaspartylglycylglutamin…
ylaspartyltyrosylthreonylhistidyllysyl…
artylglycylthreonylglutaminylserylleuc…
ylthreonylprolylserylaspartylserylglyc…
lylalanylglutaminylasparaginylarginyla…
ylserylvalylisoleucylleucylthreonylval…
ylglutaminylvalyllysylprolylmethionylp…
lysylasparaginylvalylasparaginylisoleu…
eucylglutamylmethionyllysylvalylarginy…
lylasparaginylprolylaspartylisoleucylv…
lserylaspartylisoleucylisoleucylvalylp…
lisoleucylarginylisoleucylglutamylglyc…
alanylleucyllysylisoleucylaspartylsery…
ylserylalanyltryptophyltyrosylthreonyl…
ginyllysylalanylglycylarginylaspartylt…
lvalylasparaginylvalylglutamylvalylglu…
ylglutamylprolylglutamylarginyllysylle…
glycylthreonyltyrosylarginylalanyllysy…
lglutamylleucylglutamylprolylleucylhis…
aminylglutamylglutaminyltryptophylglut…
osylaspartyllysylglutamyllysylglutamin…
phenylalanyllysyllysyllysylleucylthreo…
inylphenylalanylglycylprolylalanylhist…
ginylleucylthreonylprolylisoleucylsery…
ylvalylglutamyltryptophylleucylhistidy…
tamylalanylalanylasparaginylarginylleu…
inylglutamylphenylalanylglycyltyrosylc…
lycylvalylalanyltyrosylserylarginylasp…
hreonylcysteinylarginylalanylthreonyla…
laspartylhistidylthreonylserylalanylth…
rtylglutamyllysylserylleucylvalylgluta…
lylglutamylglycylarginyllysylglycylleu…
ylglutamylleucylglutamylarginylmethion…
lleucylthreonylglycylvalylthreonylthre…
lysylglutaminyllysylprolylaspartylisol…
ylprolylvalylarginylvalylleucylglutamy…
lphenylalanylarginylcysteinylarginylva…
minylprolyllysylvalylasparaginyltrypto…
lutaminylleucylisoleucylarginyllysylse…
alylarginyltyrosylaspartylglycylisoleu…
leucylvalylaspartylcysteinyllysylseryl…
ylvalyllysylvalylthreonylalanylglutamy…
ylisoleucylglutamylhistidyllysylvalyll…
ylglutaminylarginylglutamylaspartylphe…
inylarginylalanylprolylglutamylprolyla…
tidylvalylhistidylglutamylprolylglycyl…
utamylvalylglutaminyllysylvalylasparty…
threonylglutamylthreonyllysylglutamylv…
nylglutamylarginylisoleucylthreonylhis…
ylglutamylserylglutamylglutamylleucyla…
ginylarginylthreonylglutamylglutamylgl…
leucylthreonylalanylvalylglutamylleucy…
lglutamylseryltyrosylglutamylglutamyll…
laspartylglutamylleucylleucylhistidylt…
lthreonylglutamylglutamylglutamyllysyl…
amylglycyllysylisoleucylthreonylisoleu…
rolylaspartyllysylisoleucylglutamylleu…
lalanylprolyllysylisoleucylphenylalany…
serylglutaminylthreonylvalylglycylglut…
idylphenylalanylarginylvalylarginylval…
lylglutamylcysteinylglutamyltryptophyl…
ysylisoleucylglutamylarginylserylaspar…
ltyrosyltryptophylprolylglutamylaspart…
leucylvalylisoleucylarginylaspartylval…
ylalanylserylisoleucylmethionylvalylly…
cylalanylglycylglutamylthreonylserylse…
leucylvalylglutaminylalanyllysylglutam…
anylthreonylglutaminylglutamylleucylgl…
ylglutamyllysylaspartylthreonylmethion…
lcysteinylglutamylthreonylserylglutamy…
ysyltryptophyltyrosyllysylaspartylglyc…
tamylglycylaspartyllysyltyrosylarginyl…
yllysylvalylhistidylphenylalanylleucyl…
ylaspartylthreonylserylaspartylalanylg…
lvalylleucylvalylglutamylaspartylgluta…
eonylalanyllysylleucylisoleucylvalylgl…
lphenylalanylvalyllysylglutamylleucylg…
alylprolylglutamylseryltyrosylserylgly…
soleucylvalylserylprolylglutamylaspara…
yptophyltyrosylhistidylasparaginylaspa…
paraginylglycyllysyltyrosylthreonyliso…
ycylarginylglutaminylasparaginylleucyl…
onyllysylglutamylaspartylglutaminylgly…
valylisoleucylaspartylglycyllysyllysyl…
llysylmethionyllysylprolylarginylproly…
aminylglycylleucylserylaspartylglutami…
laspartylisoleucylvalylglutaminylleucy…
glutamylserylvalylglutamylglycylvalylt…
ylglutaminylglutamylvalylglutaminylpro…
lisoleucylvalylisoleucylaspartyllysylg…
ylleucylisoleucylglutamylaspartylmethi…
anylglycylasparaginyltyrosylserylpheny…
lleucylglycylleucylserylthreonylserylg…
erylvalylaspartylvalylisoleucylthreony…
raginylvalylisoleucylglutamylglycylthr…
cysteinyllysylvalylserylvalylprolylasp…
yptophyltyrosylleucylasparaginylaspart…
rolylaspartylaspartylarginylvalylgluta…
lthreonyllysylglutaminylarginylleucylv…
onylhistidylalanylserylaspartylglutamy…
eucylvalylglycylarginylvalylglutamylth…
ylleucylserylvalylglutamyllysylisoleuc…
cylleucylarginylaspartylleucylthreonyl…
utaminylasparaginylvalylvalylphenylala…
histidylserylglycylisoleucylaspartylva…
lalanyllysylaspartyllysylglutamylisole…
yllysylisoleucylglutamylalanylhistidyl…
cylthreonylvalylleucylasparaginylmethi…
lutamylglycyllysyltyrosylthreonylpheny…
sparaginylmethionylthreonylserylglycyl…
lglycylalanylisoleucylseryllysylprolyl…
eonylvalylalanylglutamylserylglutaminy…
tamylcysteinylglutamylvalylalanylaspar…
lglutamyltryptophylleucylarginylaspart…
ucylthreonylasparaginylasparaginylisol…
tylglycylhistidyllysylarginylarginylle…
hreonyllysylleucylaspartylaspartylisol…
yrosyllysylvalylalanylthreonylseryllys…
ylvalylglutamylalanylvalyllysylisoleuc…
raginylleucylthreonylvalylthreonylglut…
lvalylphenylalanylthreonylvalylglutamy…
ginylvalyllysylglycylvalylglutaminyltr…
ycylvalylvalylleucylglutamylserylaspar…
leucylserylvalyllysylglycylthreonyliso…
eucyllysylasparaginylcysteinylalanylis…
lyltyrosylglycylphenylalanylarginylleu…
erylalanylarginylleucylhistidylvalylgl…
oleucyllysyllysylprolyllysylaspartylva…
raginylalanylthreonylvalylalanylphenyl…
istidylaspartylthreonylvalylprolylvaly…
llysylserylvalylglutamylisoleucyllysyl…
inylleucylvalylserylglutamylarginyllys…
leucylglutaminylasparaginylisoleucylse…
lutamyltyrosylthreonylalanylvalylvalyl…
inyllysylalanyllysylleucylphenylalanyl…
isoleucylthreonyllysylthreonylmethiony…
alylprolylglutamylthreonyllysylthreony…
teinylglutamylvalylserylhistidylphenyl…
thionyltryptophylleucyllysylasparaginy…
ylmethionylserylglutamyllysylphenylala…
ylglycyllysylleucylhistidylglutaminyll…
araginylthreonylserylthreonylglutamyla…
reonylphenylalanylvalylcysteinylglycyl…
erylalanylthreonylleucylthreonylvalylt…
eucylthreonylserylmethionylleucyllysyl…
lutamylglutamyllysylaspartylthreonylis…
valylthreonylvalylasparaginyltyrosylgl…
syltryptophylleucyllysylasparaginylgly…
threonylaspartyllysylcysteinylglutamin…
lleucylthreonylhistidylserylleucylaspa…
alylhistidylphenylalanylglycylaspartyl…
phenylalanylvalylalanylglycyllysylalan…
ylleucyltyrosylvalylglutamylalanylargi…
lanylarginyllysylhistidylisoleucyllysy…
lutamyllysyllysylarginylalanylmethiony…
mylvalylserylglutamylprolylaspartyliso…
phylmethionyllysylaspartylaspartylglut…
ucylthreonylaspartylarginylisoleucylly…
lysyltyrosylvalylhistidylarginylleucyl…
rginylmethionylserylaspartylalanylglyc…
nylglycylglycylasparaginylvalylserylth…
valylglutamylglycylarginylaspartylvaly…
cyllysyllysylglutamylvalylglutaminylva…
arginylalanylvalylvalylglutamylphenyla…
ylaspartylaspartylvalylaspartylalanylh…
ylglycylisoleucylglutamylisoleucylaspa…
lutaminylglutamylarginylhistidyllysylt…
nylisoleucylhistidylarginylmethionylph…
eonylarginylglutaminylserylaspartylala…
nylalanylvalylalanylglycylarginylaspar…
lleucyltyrosylvalylasparaginylalanylpr…
alylleucylglutaminylglutamylleucylglut…
minylserylglycyllysylprolylalanylargin…
nylisoleucylserylglycylarginylprolylgl…
yptophyltyrosyllysylglutamylglutamylgl…
ycylphenylalanyllysylcysteinyllysylphe…
ylglutaminylglutamyltyrosylthreonylleu…
nylphenylalanylprolylglutamylaspartyla…
einylglutamylalanyllysylasparaginylasp…
ylthreonylserylalanylserylleucylserylv…
lvalylserylprolylaspartylglutaminylglu…
lylprolylalanylisoleucylisoleucylthreo…
reonylvalylthreonylserylglutamylglycyl…
alanylglutaminylcysteinylarginylvalyls…
ylvalylseryltryptophyltyrosylseryllysy…
olylserylarginylphenylalanylphenylalan…
lphenylalanylglutamylaspartylthreonylt…
ucylalanylglutamylalanyltyrosylprolylg…
yltyrosylthreonylphenylalanylvalylalan…
glycylglutaminylvalylserylserylthreony…
glutamylalanylprolylglutamylserylisole…
oleucylglutamylglutaminylglutamylisole…
nyllysylglutamylphenylalanylserylseryl…
lutamylglutamylglutamylglycylleucylhis…
minylleucylseryllysylisoleucylasparagi…
ucylleucylserylglutamylserylprolylvaly…
anylaspartylserylglutamyllysylglutamyl…
phenylalanylisoleucyllysylglutamylvaly…
eucylserylmethionylglycylaspartylvalyl…
nylvalylisoleucylglycylisoleucylprolyl…
tryptophylphenylalanylphenylalanylaspa…
nylprolylserylalanylaspartyltyrosyllys…
rtylglycylaspartylaspartylhistidylsery…
ylalanylthreonyllysylleucylglutamylasp…
hreonylcysteinylmethionylalanylserylas…
threonylisoleucylcysteinylserylalanylt…
ylseryllysylglycylglutamylglycylhistid…
onylglutamylserylalanylvalylalanyllysy…
ylglycylprolylcysteinylprolylprolylhis…
lleucyllysylprolylisoleucylarginylcyst…
olylalanylisoleucylphenylalanylglutamy…
tamylprolylalanylprolylthreonylvalylth…
utamylasparaginyllysylglutaminylleucyl…
yrosylthreonylisoleucylisoleucylhistid…
lserylglycylthreonylphenylalanylisoleu…
utaminylarginylglutamylaspartylserylgl…
lysylalanylglutamylasparaginylmethiony…
ysteinylalanylalanylglutamylleucylleuc…
threonylaspartylmethionylthreonylaspar…
yllysylserylthreonylprolylglutamylalan…
lprolylglutaminylthreonylprolylleucyll…
alanylleucylaspartylserylglutamylgluta…
lphenylalanylvalyllysylaspartylthreony…
ucylisoleucylthreonylglutamylglutamyla…
lseryltyrosylglutamylhistidylisoleucyl…
lleucylserylserylglutaminylleucylproly…
ylleucylglutaminylserylisoleucylleucyl…
ylthreonylprolylglutamylserylthreonyla…
teinylisoleucylasparaginylglycylseryli…
nylprolylleucyllysylglutamylprolylsery…
eucylglutaminylisoleucylvalylglutaminy…
alanylseryllysylglutamylglycylisoleucy…
mylprolylglutamylthreonylglutaminylala…
glutamyllysylisoleucylphenylalanylprol…
lglutamylglutaminylisoleucylasparaginy…
olylleucyllysylthreonylleucylleucylala…
raginyltyrosylprolylglutaminylserylser…
ionylhistidylseryltyrosylleucylthreony…
lylleucylserylleucyllysylglutamyllysyl…
sparaginylarginylglutamylglutaminylarg…
sylglutaminylglutamylalanylglutaminyls…
lglutaminylserylleucylalanylglutamylgl…
lglutaminylserylprolylaspartylvalylmet…
asparaginyltyrosylglutamylprolylleucyl…
ylcysteinylthreonylglutamylglycylglycy…
mylserylalanylasparaginylprolylleucylg…
minylaspartylserylalanylvalylarginylis…
erylleucylarginylphenylalanylprolylleu…
lglutaminylvalylleucylleucyllysylgluta…
araginylvalylvalylmethionylprolylproly…
ylglutamylseryllysylarginylglutamylpro…
lylglutaminylglutamylvalylglutaminylgl…
llysylglutamylserylleucylleucylserylgl…
glutaminylarginylleucylasparaginylleuc…
cysteinylarginylalanylleucylglutaminyl…
lglutaminylprolylglycylleucylphenylala…
inylasparaginylisoleucylglutamyllysylv…
lasparaginylisoleucylthreonylglutaminy…
ucylmethionylcysteinylmethionyltyrosyl…
serylvalylthreonylglutamylglutamylvaly…
lglutamylaspartylvalylaspartylprolylgl…
eucyllysylmethionylglutamylleucylargin…
ylisoleucylisoleucyltyrosylglutamylglu…
ylthreonylalanylglutamylglycylprolylar…
lycylalanyllysylthreonylserylleucylglu…
artylserylphenylalanylserylglycylseryl…
soleucylthreonylglutamylprolylglutamyl…
lisoleucylserylthreonylglutamylglutamy…
aginylvalylglutaminylserylarginylvalyl…
eonylprolylvalylthreonyllysylglycylval…
spartylglutamyllysylglutaminylaspartyl…
glutamylglutamyllysylglutamylglutamyls…
reonylglutamylglutamylvalylalanylthreo…
tamylalanylglutamylglycylglycylleucyli…
prolylmethionylisoleucylhistidylthreon…
valylserylglutamylglutamylglycylaspart…
nylthreonylserylisoleucylthreonylaspar…
aginyltryptophyltyrosylphenylalanylglu…
lylserylaspartylglutamyllysylphenylala…
partylglutaminylasparaginylthreonyltyr…
artyllysylvalylasparaginylthreonylglut…
lglutamyltyrosylvalylcysteinylglutamyl…
lglycyllysylthreonylalanylthreonylsery…
llysylarginylalanylalanylprolylvalylis…
utamylprolylleucylglutamylvalylalanyll…
lphenylalanylthreonylcysteinylglutamyl…
lasparaginylvalylarginylphenylalanylgl…
alanylglycylarginylglutamylisoleucylty…
einylserylisoleucylarginylserylserylly…
glutamylisoleucylleucylarginylthreonyl…
ylglycylglutamyltyrosylthreonylcystein…
yltyrosylglycylserylvalylserylcysteiny…
ylvalylthreonylvalylprolylglycylglycyl…
leucylleucylprolylglutamylarginyllysyl…
utamylvalylvalylleucyllysylserylvalyll…
mylglutamylglutamylglutamylprolyllysyl…
glutamyllysylvalyllysyllysylprolylalan…
olylprolyllysylprolylvalylglutamylglut…
lvalylthreonyllysylarginylglutamylargi…
ylthreonyllysylvalylprolylglutamylisol…
ylleucylprolylalanylprolylglutamylprol…
nylglutamylvalyllysylthreonylisoleucyl…
lprolylglutamylprolylthreonylprolyliso…
ylvalylprolylvalylvalylglycyllysyllysy…
lyllysylglutamylglutamylalanylalanylly…
lysylglycylvalylprolyllysyllysylthreon…
lalanylglutamylarginylarginyllysylleuc…
cylglutamyllysylprolylprolylaspartylgl…
nyltyrosylglutaminylleucyllysylalanylv…
lyllysylglutamylisoleucyllysylaspartyl…
tamylserylglutamylphenylalanylvalylgly…
lanylglutamylcysteinylleucylvalylseryl…
hreonylthreonyltryptophylmethionyllysy…
eucylarginylglutamylserylprolyllysylhi…
lanylaspartylglycyllysylaspartylarginy…
cylaspartylvalylglutaminylleucylseryla…
hreonylcysteinylvalylleucylarginylleuc…
ylthreonylserylthreonylalanyllysylleuc…
rolylvalylarginylphenylalanylvalyllysy…
amylvalylthreonylvalylvalyllysylglycyl…
serylcysteinylglutamylleucylasparaginy…
alyltryptophylarginyllysylaspartylglyc…
ysylprolylglycylarginylisoleucylvalylp…
ylmethionylarginylalanylleucylthreonyl…
spartylaspartylthreonylaspartylalanylg…
reonylvalylglutamylasparaginylalanylas…
ysteinylserylserylcysteinylvalyllysylv…
nylaspartyltryptophylleucylvalyllysylp…
inylhistidylvalyllysylprolyllysylglycy…
lalanylcysteinylaspartylisoleucylalany…
inylisoleucyllysyltryptophylphenylalan…
lisoleucylprolylalanylglutamylprolylas…
mylisoleucylleucylarginylaspartylglycy…
ucyllysylisoleucyllysylasparaginylalan…
oleucylalanylglutamyltyrosylalanylvaly…
ylarginyltyrosylprolylalanyllysylleucy…
lglutamylvalylglutamylleucylleucyllysy…
ylthreonylisoleucyltyrosylglutamyllysy…
ylaspartylalanylglutamylisoleucylseryl…
ylglycylglutaminyltryptophyllysylleucy…
inylprolylserylprolylthreonylcysteinyl…
lglycylglycyllysylarginylphenylalanyll…
yllysylleucylaspartylglutaminylalanylg…
aminylalanylleucylasparaginylalanyliso…
ylleucylthreonylvalyllysylglutamylisol…
anylalanylvalylprolylleucyllysylaspart…
rginylarginylglutaminylalanylarginylph…
cylthreonylarginylglutamylalanylaspara…
ysylglycylprolylaspartylisoleucylisole…
nylalanylaspartylisoleucylisoleucylala…
isoleucylleucylvalylisoleucylasparagin…
ylaspartylaspartylglutamylglycylvalylt…
utamylglycyllysyllysylthreonylserylala…
reonylglycylisoleucylarginylleucyllysy…
ucylglutamylaspartylglutaminylthreonyl…
eonylalanylthreonylphenylalanylvalylcy…
lutamyllysylmethionylhistidylvalylvaly…
inylaspartylalanyllysylleucylhistidylt…
cylisoleucylserylserylglutamylglycylly…
mylmethionyllysylglutamylvalylthreonyl…
lglutaminylisoleucyllysylalanylglutami…
ylthreonylalanylglutaminylleucyllysylv…
lyltyrosylphenylalanylthreonylvalyllys…
ylalanylvalylglutamyllysylaspartylglut…
teinylglutamylvalylseryllysylaspartylv…
lalanyllysylaspartylglycylglutamylglut…
lysyltyrosylserylisoleucyllysylalanyla…
oleucylleucyllysylisoleucyllysyllysyla…
ylglycylglutamyltyrosylvalylcysteinyla…
tyllysylthreonyllysylalanylasparaginyl…
inylleucylisoleucylglutamylvalylglutam…
ylglutamylvalylphenylalanylvalylglycyl…
lalanylglutamylisoleucylglutamylleucyl…
tidylglycylglutaminyltryptophyllysylle…
ylthreonylalanylserylprolylaspartylcys…
tamylaspartylglycyllysyllysylhistidyli…
ylasparaginylcysteinylglutaminylleucyl…
ylvalylserylphenylalanylglutaminylalan…
alanylalanylasparaginylleucyllysylvaly…
leucylphenylalanylisoleucylthreonylpro…
ylphenylalanylglutamyllysylaspartylglu…
lcysteinylglutamylvalylserylarginylglu…
larginyltryptophylleucyllysylglycylthr…
eonylglycylaspartylaspartylarginylphen…
laspartylglycylthreonyllysylhistidylse…
lalanylalanylphenylalanylglutamylaspar…
nylphenylalanylglutamylalanylglutamyla…
ycyllysylleucylisoleucylisoleucylgluta…
lphenylalanylleucylthreonylprolylleucy…
sylglutamyllysylglutamylserylalanylval…
leucylserylhistidylaspartylasparaginyl…
lphenylalanyllysylasparaginylaspartylg…
nylthreonylarginylserylvalylserylmethi…
llysylthreonylhistidylserylisoleucylth…
ylserylisoleucylaspartylaspartylthreon…
lylglutamylalanylmethionylglycylmethio…
cylthreonylvalylleucylglutamylglycylas…
onylglycyllysylleucylglutaminylasparty…
lysylaspartylglutamylvalylisoleucylleu…
ucylseryllysylalanylaspartylalanylprol…
ysylaspartylglycyllysylglutamylisoleuc…
lanylvalylisoleucyllysylthreonylaspart…
eucylisoleucylleucyllysyllysylalanylle…
ylglutaminyltyrosylthreonylcysteinylas…
yllysylthreonylserylglycyllysylleucyla…
inylglutamylisoleucyllysylleucylvalyla…
lglutamylvalylmethionylglutamylthreony…
lalanylglutamylthreonylglutamylisoleuc…
eucylhistidylalanylasparaginyltryptoph…
nylleucylleucylglutaminylthreonylproly…
lysylglutamylglutamylglycyllysylisoleu…
stidylasparaginylcysteinylarginylleucy…
ycylvalylaspartylphenylalanylglutaminy…
erylserylalanylhistidylleucylarginylva…
glycylleucylleucylarginylprolylleucyll…
nylalanylglycylglutamylthreonylalanylt…
lglutamylleucylseryltyrosylglutamylasp…
yptophyltyrosylleucyllysylglycyllysyll…
yllysylvalylvalylprolylarginylserylglu…
ylleucylthreonylleucylarginylaspartylv…
ylglycylglutamylvalylglutaminylleucylt…
nyllysylthreonylhistidylalanylasparagi…
amylprolylprolylvalylglutamylphenylala…
laspartylglutaminylthreonylvalylglutam…
lvalylleucylglutamylcysteinylglutamylv…
alanyllysylvalyllysyltryptophylphenyla…
glutamylisoleucylleucyllysylseryllysyl…
lanylaspartylglycylarginylvalylarginyl…
partylcysteinylthreonylprolylglutamyla…
lthreonylcysteinylaspartylalanyllysyla…
ylcysteinylasparaginylleucylasparaginy…
lglutamylphenylalanylleucylarginylprol…
minylvalylarginylglutamyllysylglutamyl…
lutamylcysteinylglutamylleucylserylarg…
alyllysyltryptophylphenylalanyllysylas…
lysyllysylglycyllysyllysyltyrosylaspar…
ylalanylvalylarginylisoleucylleucylval…
lleucylleucylaspartylaspartylglutamyla…
lutamylvalylarginylthreonylalanylargin…
lthreonylvalylleucylglutamylglutamylgl…
yllysylasparaginylleucylalanylasparagi…
mylthreonylaspartylthreonylisoleucylly…
lseryllysylprolylglycylalanylglutamylv…
glycylaspartylglutamylglutamylisoleucy…
inyltyrosylglutamylisoleucylleucylthre…
ylisoleucylleucylvalylisoleucylglutami…
lutamylaspartylalanylglycylasparaginyl…
eucylprolylserylserylarginylthreonylas…
tidylglutamylleucylalanylalanylglutamy…
lylglutaminylasparaginylleucylglutamyl…
yllysylalanylglutamylphenylalanylvalyl…
utamylserylphenylalanylprolylvalylglut…
laspartyllysylthreonylleucylglutamylse…
ylvalylisoleucylalanylaspartylglycylly…
llysylaspartylalanylthreonylleucylglut…
yltyrosylvalylvalylmethionylvalylglycy…
nylhistidylleucylthreonylvalylisoleucy…
lvalylvalylprolylleucyllysylaspartylth…
aminylglutaminylglutamylvalylvalylphen…
lvalylasparaginylthreonylglutamylglycy…
enylalanylarginylasparaginylglutamylgl…
partylserylseryllysyltyrosylisoleucyli…
ylleucylvalyltyrosylthreonylleucylargi…
stidylleucylaspartylaspartylglutaminyl…
valylserylleucylthreonylasparaginylhis…
ylvalyllysylserylalanylalanylasparagin…
mylglutamylaspartylleucylarginylisoleu…
partylisoleucylglutamylthreonylmethion…
nylphenylalanyltryptophylcysteinyllysy…
aginylvalylthreonylleucyllysyltryptoph…
tamylglutamylvalylprolylphenylalanylas…
yrosylarginylvalylaspartyllysyltyrosyl…
lisoleucyllysylaspartylcysteinylglycyl…
lycylglutamyltyrosylisoleucylvalylthre…
ysylserylvalylalanylglutamylleucylleuc…
rolylthreonylglutamylphenylalanylvalyl…
tylglutaminylthreonylvalylthreonylglut…
nylvalylphenylalanylserylcysteinylglut…
ylalanylasparaginylvalyllysyltryptophy…
inylglutamylisoleucyllysylglutamylglyc…
lglutamyllysylaspartylglycylserylisole…
soleucyllysylaspartylcysteinylarginyll…
nylglutamyltyrosylalanylcysteinylglycy…
erylarginylalanylarginylleucylphenylal…
rolylvalylglutamylisoleucylisoleucylar…
isoleucylleucylglutamylalanylprolylgly…
anylleucylalanylglutamylleucylasparagi…
alylglutaminyltryptophylleucylarginyla…
valylvalylglutaminylglycylaspartyllysy…
ylserylglutamylglycyllysylisoleucylhis…
ylcysteinylaspartylisoleucyllysylproly…
tamyltyrosylarginylphenylalanylisoleuc…
lanylarginylalanyllysylleucylglutamyll…
soleucyllysylthreonylalanylaspartylglu…
rtylvalylglycyllysylprolylleucylthreon…
spartylalanyltyrosylprolyllysylalanylg…
ylalanyllysylglutamylasparaginylglutam…
eonylisoleucylaspartylthreonylthreonyl…
ylphenylalanylarginylisoleucylleucylgl…
llysylglycylarginyltyrosyllysylisoleuc…
ysylhistidylglycyllysylalanylglutamylg…
ylleucyllysylvalylisoleucylaspartylval…
araginylleucylglutamylvalylthreonylglu…
ycylglutamylvalylserylleucylalanyltryp…
hreonylaspartylglycylglycylseryllysyli…
valylglutamylarginylarginylaspartyliso…
tophylvalylleucylalanylthreonylasparty…
lglutamylphenylalanylthreonylvalylthre…
ylglycylvalylglutamyltyrosylleucylphen…
nylasparaginylarginylvalylglycylthreon…
threonylaspartylasparaginylprolylvalyl…
sylaspartylvalylprolylglycylprolylprol…
leucylthreonylaspartylvalylasparaginyl…
leucylthreonyltryptophylglutamylprolyl…
glycylalanylglutamylisoleucylthreonyla…
amylleucylarginylaspartyllysylthreonyl…
rtylthreonylalanylmethionylthreonylval…
ylserylalanylthreonylvalylthreonylaspa…
nylglutamyltyrosylserylphenylalanylarg…
araginylarginylisoleucylglycylvalylgly…
onylprolylphenylalanylvalyllysylvalyla…
larginylprolylserylprolylprolylvalylas…
partylglutaminylthreonylglutaminylsery…
ptophylglutamylprolylprolylleucyllysyl…
eucylleucylglycyltyrosylisoleucylisole…
lglutamylglycyllysylaspartylasparaginy…
lasparaginylmethionyllysylleucylvalylp…
ysylvalylthreonylglycylleucylglutamyll…
ucyltyrosylarginylvalylserylalanylglut…
ylserylaspartylprolylserylglutamylisol…
ylalanylaspartylaspartylalanylphenylal…
ionylaspartylleucylserylalanylphenylal…
ylvalylisoleucylvalylprolylasparaginyl…
cylvalylprolylserylthreonylglycyltyros…
threonyltryptophylcysteinylphenylalany…
amylthreonylglycylaspartylarginylvalyl…
rylalanyltyrosylalanylglutamylleucylva…
larginylserylaspartyllysylglycylisoleu…
glutamylasparaginylarginylvalyllysylth…
soleucylaspartylvalylasparaginylvalyli…
nylprolyllysylglutamylleucyllysylpheny…
nyllysylaspartylserylvalylhistidylleuc…
rolylaspartylaspartylaspartylglycylgly…
yrosylvalylvalylglutamyllysylarginylgl…
ltryptophylthreonyllysylvalylmethionyl…
partylleucylglutamylphenylalanylthreon…
taminylglycyllysylglutamyltyrosylleucy…
nylarginylasparaginyllysylcysteinylgly…
tyrosylvalylaspartylglutamylprolylvaly…
rolylalanylthreonylvalylprolylaspartyl…
llysyltryptophylarginylaspartylarginyl…
ucylphenylalanylleucylthreonyltryptoph…
nylaspartylglycylglycylserylarginyliso…
lylglutamylarginylcysteinylprolylargin…
lvalylalanylcysteinylglycylglutamylpro…
methionylglutamylvalylthreonylglycylle…
tophyltyrosylalanyltyrosylarginylvalyl…
ylglutaminylglycylalanylseryllysylprol…
lglutamylisoleucylglutaminylalanylvaly…
alanylprolylglutamylisoleucylphenylala…
ucylalanylglycylleucylthreonylvalyllys…
lglutamylleucylprolylalanylthreonylval…
prolyllysylisoleucylthreonyltryptophyl…
lisoleucylleucyllysylglutaminylasparty…
ucylglutamylasparaginylvalylprolyllysy…
leucylvalylaspartylseryllysylarginylse…
rosylisoleucylisoleucylglutamylalanylv…
arginylalanylthreonylalanylvalylvalylg…
spartyllysylprolylglycylprolylprolylal…
ucylthreonylaspartylvalylthreonylaspar…
eucylthreonyltryptophylasparaginylprol…
ylglycylseryllysylisoleucylthreonylasp…
ginylarginylalanylthreonylaspartylsery…
ylleucylserylserylthreonylvalyllysylas…
yllysylalanylthreonyllysylleucylisoleu…
rosylisoleucylphenylalanylarginylvalyl…
ionyltyrosylglycylalanylglycylglutamyl…
lylisoleucylthreonylalanyllysyltyrosyl…
lprolylglycylprolylprolylthreonylargin…
isoleucylthreonyllysylaspartylalanylva…
cysteinylglutamylprolylaspartylasparty…
leucylthreonylglycyltyrosyltryptophylv…
olylaspartylthreonylaspartyllysyltrypt…
yllysylmethionylprolylvalyllysylaspart…
yllysylglycylleucylthreonylasparaginyl…
alanylarginylvalylleucylalanylglutamyl…
glycyllysylprolylseryllysylserylthreon…
eucyllysylaspartylprolylisoleucylaspar…
ylglycyllysylprolylthreonylvalyllysyla…
lvalylarginylleucylasparaginyltryptoph…
ylaspartylglycylglycylalanyllysylisole…
cylglutamylmethionylleucyllysylthreony…
tophylvalylarginylvalylalanylglutamylg…
taminylhistidylleucylleucylprolylglycy…
minylglutamyltyrosylserylphenylalanyla…
ginyllysylalanylglycylglutamylserylglu…
aspartylprolylvalylleucylcysteinylargi…
prolylserylprolylprolylarginyltryptoph…
aginylisoleucylthreonyllysylasparaginy…
ryptophylthreonylvalylprolylglutamylly…
soleucylthreonylasparaginyltyrosylisol…
tylvalylarginylarginyllysylglycyltrypt…
lthreonylthreonylvalyllysylaspartylthr…
eonylprolylleucylthreonylglutamylglycy…
larginylvalylalanylalanylglutamylaspar…
ylserylaspartyltyrosylthreonylglutamyl…
leucylalanyllysylaspartylthreonylpheny…
prolylprolyltyrosylalanylleucylalanylv…
arginylhistidylvalylaspartylleucyllysy…
lasparaginylaspartylglycylglycylarginy…
rosylvalylisoleucylglutamyllysyllysylg…
rginyltryptophylvalyllysylalanylglycyl…
rtylcysteinylasparaginylphenylalanylar…
eucylglutamylglycylthreonylglutamylval…
alylarginylalanylglutamylasparaginylgl…
ylprolylserylglutamylprolylthreonylglu…
lutamylaspartylprolylthreonylserylprol…
rtylleucylhistidylvalylthreonylasparty…
oleucylalanylisoleucylalanyltryptophyl…
aginylglycylglycylserylprolylisoleucyl…
glutamylmethionylcysteinylprolylvalylg…
lmethionylarginylvalylasparaginylseryl…
leucyllysylphenylalanyllysylvalylgluta…
partyllysylglutamyltyrosylvalylleucyla…
ginylalanylisoleucylglycylvalylserylgl…
erylglutamylasparaginylvalylvalylalany…
yllysylprolylthreonylisoleucylaspartyl…
tylisoleucylisoleucylvalylisoleucylglu…
isoleucylprolylvalylprolylphenylalanyl…
threonylvalylseryltryptophylhistidylly…
lysylalanylserylaspartylarginylleucylt…
artylhistidylisoleucylserylalanylhisti…
rylvalylarginylalanylaspartylalanylgly…
lthreonylleucylglutamylasparaginyllysy…
nylserylisoleucylasparaginylvalyllysyl…
cylprolylcysteinyllysylaspartylisoleuc…
threonyllysylserylserylcysteinyllysyll…
ylprolylglutamylphenylalanylaspartylgl…
ucylhistidyltyrosylvalylleucylglutamyl…
rginylarginylthreonyltyrosylisoleucylp…
mylasparaginyllysylleucylseryltryptoph…
soleucylprolylasparaginylglycylglutamy…
inylvalyllysylalanylvalylasparaginylly…
yrosylisoleucylglutamylleucyllysylaspa…
utaminylaspartylprolyllysylglutaminylp…
laspartylvalylglutamylvalylhistidylasp…
lalanylmethionylthreonylisoleucylthreo…
ltyrosylaspartylglycylglycylseryllysyl…
eucylisoleucylglutamyllysylisoleucylal…
nyltryptophyllysylarginylcysteinylaspa…
rolylisoleucylleucylthreonyltyrosylthr…
lglutamylglycyllysylglutamyltyrosylglu…
nylalanylglutamylasparaginylalanylalan…
lserylarginylalanylthreonylprolylproly…
olylisoleucylaspartylalanylprolyllysyl…
serylleucylglutamylvalyllysylarginylgl…
leucylaspartylalanylserylisoleucylsery…
onylisoleucylthreonyltryptophylisoleuc…
alylisoleucylvalylprolylglutamylglutam…
lanylprolylleucylvalylarginylarginylar…
inylglutamylglutamylglutamylprolylphen…
onylglutaminylarginylleucylserylisoleu…
ylglycylglutamylserylglutaminylleucyla…
ylarginylprolylaspartylhistidylglycyll…
valylglutamylasparaginylaspartylhistid…
rolylcysteinylthreonylvalylserylvalyll…
olylprolylisoleucylasparaginylphenylal…
ylisoleucylarginyllysylthreonylserylva…
utamylprolylprolylleucylaspartylaspart…
lisoleucylasparaginyltyrosylthreonylle…
threonyllysylprolylaspartylserylglutam…
onylserylthreonylleucylarginylhistidyl…
onyllysylleucylisoleucylglutamylglycyl…
nylarginylvalylarginylalanylglutamylas…
rolylglycylprolylprolylcysteinylvalyls…
ylaspartylprolylphenylalanylglycylprol…
llysylprolylisoleucylvalylglutamylaspa…
rylmethionylleucylvalyllysyltryptophyl…
tylasparaginylglycylserylprolylisoleuc…
ylglutamyllysylarginylglutamylvalylasp…
phylserylarginylvalylasparaginyllysyls…
ucyllysylalanylasparaginylvalylasparty…
ucylthreonyltyrosylvalylphenylalanylar…
paraginylalanylalanylglycylprolylglycy…
serylaspartylprolyllysylthreonylalanyl…
lprolylprolylglycylprolylprolylisoleuc…
lthreonylserylserylthreonylthreonyliso…
hylglutamylprolylprolylalanylphenylala…
tamylisoleucylvalylglycyltyrosylphenyl…
eucylvalylglycylthreonylasparaginyllys…
reonylglutamyllysylmethionylisoleucyll…
reonylvalyllysylglutamylisoleucylargin…
yllysylleucylarginylvalylserylalanylva…
tamylglycylprolylprolylglycylglutamylt…
lvalylalanylglutamylprolylglutaminylgl…
ylleucylaspartylvalylserylvalyllysylgl…
cylmethionylalanylglycyllysylthreonyll…
lylvalylthreonylglycylarginylprolylval…
lthreonyllysylglutamylglutamylglycylgl…
ginylvalylvalylisoleucylaspartylaspara…
lutamylleucylisoleucylisoleucyllysylas…
tylhistidylglycylarginyltyrosylvalylis…
ginylserylcysteinylglycylseryllysylphe…
alylglutamylvalylphenylalanylaspartylv…
partylleucyllysylprolylvalylvalylthreo…
cysteinylleucylleucylasparaginyltrypto…
rtylaspartylglycylglycylserylglutamyli…
soleucylisoleucylglutamylarginyllysyla…
threonyltryptophylarginylglutaminylpro…
larginylseryllysylcysteinylaspartyliso…
tamylglycylglutaminylglutamyltyrosylly…
lalanyllysylasparaginyllysylphenylalan…
valylglutamylisoleucylglycylprolylisol…
lleucylglycylprolylprolylthreonylseryl…
tyrosylthreonylglutamylarginylglutamin…
onylleucylaspartyltryptophyllysylgluta…
cylglycylserylprolylisoleucylglutaminy…
tamyllysylarginylarginylhistidylaspart…
utamylarginylvalylasparaginyllysylargi…
eonylserylphenylalanylleucylvalylgluta…
lhistidylglutaminylmethionyltyrosylglu…
lanylvalylasparaginylglutamylisoleucyl…
rylleucylprolylleucylasparaginylvalylv…
rtylglutamylvalylprolylprolylthreonyli…
ylvalylarginylglycylaspartylthreonylis…
lutamylprolylvalylhistidylisoleucylpro…
lleucylprolylmethionylprolyllysylisole…
araginylglutamylthreonylvalylisoleucyl…
alanylleucylglutaminylisoleucylthreony…
inylserylglutamylalanyllysylthreonylgl…
ylalanylvalylarginylglutamylaspartylly…
ylthreonylalanylserylasparaginylarginy…
arginylasparaginylvalylhistidylvalylgl…
olylserylprolylprolylarginylasparaginy…
soleucyllysylalanylglutamylserylcystei…
spartylalanylprolylleucylaspartylaspar…
eucylthreonylhistidyltyrosylvalylisole…
nylserylarginyllysyllysylalanylglutamy…
eonylasparaginylthreonylalanylvalylglu…
ucyltryptophyllysylleucylisoleucylprol…
lglutamylphenylalanylarginylvalylargin…
lglycylisoleucylserylaspartylglutamylc…
lvalylisoleucylglutaminylaspartylproly…
olylprolylglycyllysylprolyllysylvalyll…
ylserylmethionylleucylvalylseryltrypto…
tylasparaginylglycylglycylserylprolyli…
phylleucylglutamyllysylarginylglutamyl…
ptophylserylarginylvalylserylarginylal…
ylglycylleucyllysylglycylvalylglutamyl…
rginylleucylleucylglutamylglycylvalyll…
ginylalanylmethionylalanylisoleucylasp…
glycylprolylprolylserylglutamylprolyls…
ylglycylaspartylprolylisoleucylphenyla…
serylcysteinylprolylglutamylvalyllysyl…
lisoleucylserylleucylglycyltryptophyll…
glycylglycylserylprolylisoleucyllysylg…
ethionylglutaminylglutamylglutamylglyc…
llysylarginylvalylasparaginylglutamylp…
reonylthreonylcysteinylglutamylcystein…
lysylglutamylleucylarginyllysyltyrosyl…
lalanylvalylasparaginylglutamylalanylg…
ylaspartylthreonylthreonylglycylglutam…
rtylisoleucylglutaminylglutamylglutamy…
leucylaspartylisoleucylglycylalanylglu…
cysteinyllysylalanylglycylserylglutami…
lanylvalylisoleucyllysylglycylarginylp…
ryptophylglutamylphenylalanylaspartylg…
hionyllysylaspartylglycylvalylhistidyl…
rtylalanylglutaminylleucylglutamylthre…
erylvalylisoleucylisoleucylisoleucylpr…
rylhistidylthreonylglycyllysyltyrosyls…
araginyllysylalanylglycylglutaminyllys…
larginylvalyllysylvalylmethionylaspart…
laspartylleucyllysylvalylserylaspartyl…
cysteinylarginylleucylseryltryptophyll…
aspartylglycylglycylaspartylarginyliso…
cylglutamyllysylarginylthreonylisoleuc…
ylthreonyllysylvalylasparaginylprolyla…
threonylphenylalanylvalylvalylprolylas…
aminylglutaminyltyrosylphenylalanylphe…
lutamylasparaginylarginylphenylalanylg…
ylglutamylthreonylisoleucylglutaminyla…
aspartylprolylisoleucyltyrosylprolylpr…
sylleucyllysylisoleucylglycylleucyliso…
nylvalylhistidylleucylseryltryptophyll…
artylglycylglycylserylprolylvalylthreo…
tamylcysteinylleucylalanyltryptophylas…
ysyllysylglutamylalanyltryptophylargin…
ylarginylaspartylvalylglutamylglutamyl…
lvalylglutamylaspartylleucylvalylgluta…
mylphenylalanylarginylvalyllysylalanyl…
alylseryllysylprolylserylalanylthreony…
cysteinylglutaminylarginylprolylaspart…
ylaspartylleucyllysylglutamylphenylala…
utamylglycylthreonylasparaginylvalylas…
soleucyllysylglycylvalylprolylphenylal…
ptophylphenylalanyllysylalanylprolylpr…
inyllysylglutamylprolylvalylleucyltyro…
araginyllysylleucylvalylvalylaspartyla…
cylvalylisoleucylprolylglutaminylseryl…
glycylleucyltyrosylthreonylisoleucylth…
inylleucylglycylthreonylalanylseryllys…
araginylvalylleucylglycylarginylprolyl…
isoleucyllysylphenylalanylglutamylsery…
methionylthreonylleucylseryltryptophyl…
ylaspartylglycylglycylseryllysylisoleu…
soleucylglutamyllysylarginylglutamylal…
tryptophylvalylhistidylvalylserylseryl…
lthreonyltyrosylthreonylisoleucylproly…
tidylglutamyltyrosylvalylphenylalanyla…
minylasparaginyllysyltyrosylglycylisol…
rtylserylglutamylprolylglutamylthreony…
ylalanylserylvalylprolylglycylalanylpr…
lserylserylvalylthreonylarginylasparag…
raginyltryptophylglutamylglutamylproly…
lserylprolylvalylthreonylglycyltyrosyl…
sylaspartylthreonylthreonylseryllysyla…
paraginylarginylaspartylprolylisoleucy…
glycylvalylseryltyrosyllysylvalylthreo…
cylserylaspartyltyrosylglutaminylpheny…
leucylasparaginylalanylalanylglycylval…
ylserylaspartylprolylalanylthreonylala…
anylprolylprolylglycylprolylprolylphen…
artyltryptophylthreonyllysylserylseryl…
hylserylprolylprolylleucyllysylasparty…
lglycyltyrosylisoleucylvalylglutamylty…
ylglutamylglutamyltryptophylglutamylly…
valylarginylglycylthreonyllysylleucylv…
lutamylglycylalanylphenylalanyltyrosyl…
lanylvalylasparaginylisoleucylalanylgl…
ycylglutamylvalylthreonylaspartylvalyl…
rtylarginylleucylvalylserylprolylaspar…
anylserylvalylarginylaspartylarginylis…
ylglycylvalylisoleucylarginylisoleucyl…
cyllysylprolylprolylprolylthreonylvaly…
onylasparaginylglutamylarginylthreonyl…
lthreonylisoleucylglutamylthreonylthre…
ethionylvalylisoleucyllysylasparaginyl…
idylglutaminylglycylvalyltyrosylseryll…
utamylalanylglycylglutamylarginyllysyl…
laspartylvalylleucylaspartylvalylproly…
lylphenylalanylleucylalanylhistidylasp…
utamylserylcysteinyllysylleucylthreony…
lutamylaspartylaspartylglycylglycylser…
ltyrosylvalylisoleucylglutamyllysylarg…
inylalanyltryptophylthreonylprolylvaly…
ylarginylglutaminylasparaginylalanylth…
oleucylglutaminylglycyllysylalanyltyro…
soleucylalanylalanylglutamylasparaginy…
lprolylphenylalanylvalylglutamylthreon…
leucylarginylglutamylprolylisoleucylth…
lylglutamylaspartylleucylglutamylvalyl…
raginylthreonylvalylthreonylleucylthre…
yllysyltyrosylaspartylglycylglycylsery…
nyltyrosylvalylleucylglutamylserylargi…
tamyllysylphenylalanylhistidyllysylval…
ginylleucylleucylserylarginyllysyltyro…
sylglutamylglycylaspartylthreonyltyros…
lanylvalylasparaginylisoleucylvalylgly…
phenylalanylcysteinylthreonyllysylprol…
partylglutamylleucylalanylprolylprolyl…
lphenylalanylarginylaspartyllysylleucy…
lglutamylalanylphenylalanylalanylleucy…
lycyllysylprolyllysylprolyllysylvalyls…
rtylglutamylalanylaspartylvalylleucylg…
nylhistidylisoleucyllysylthreonylthreo…
leucylglutamyllysylisoleucyllysylalany…
yllysyltyrosylcysteinylvalylvalylvalyl…
cylserylarginyllysylglycylphenylalanyl…
valylvalylaspartylhistidylprolylglycyl…
erylphenylalanylaspartylglutamylvalylt…
lvalylisoleucylseryltryptophyllysylpro…
ylglycylseryllysylisoleucylthreonylasp…
utamyllysyllysylglutamylvalylglycyllys…
rolylvalylthreonylserylalanylserylalan…
ylvalylseryllysylleucylleucylglutamylg…
henylalanylarginylisoleucylhistidylala…
glycylisoleucylserylaspartylprolylleuc…
ysylalanyllysylaspartylarginylphenylal…
lprolylaspartylglutaminylprolylisoleuc…
llysylaspartylserylalanylleucylvalylth…
lylhistidylaspartylglycylglycyllysylpr…
osylisoleucylleucylglutamyllysylarginy…
larginyltryptophylalanylarginylvalylth…
istidylprolyltyrosylthreonyllysylpheny…
ucylleucylglutamylglycylcysteinylgluta…
inylvalylserylalanylglutamylasparaginy…
ycylaspartylprolylserylprolylprolylser…
llysylaspartylprolylisoleucylalanyllys…
aginylprolylglutamylalanylisoleucylasp…
aginylserylvalylaspartylleucylthreonyl…
inylhistidylaspartylglycylglycylseryll…
leucylvalylglutamyltyrosylglutaminylly…
myltryptophylarginylarginylalanylaspar…
lserylcysteinylprolylglutamylthreonyll…
leucylarginylaspartylglycylglutaminylt…
nylvalylleucylalanylvalylasparaginylal…
ylprolylalanylhistidylvalylprolylgluta…
tylarginylleucylglutamylprolylprolylgl…
alanylasparaginylmethionylalanylarginy…
llysylvalylglycylaspartylthreonylleucy…
soleucyllysylglycylvalylprolylphenylal…
hyllysyllysylglutamylaspartylarginylas…
ylarginylisoleucylaspartylvalylthreony…
lutamylisoleucylarginylasparaginylalan…
cylglycylisoleucyltyrosylserylleucylth…
lalanylglycylseryllysylthreonylvalylse…
aspartyllysylprolylglycylprolylprolyla…
rylglutamylisoleucylarginyllysylaspart…
yltryptophyllysylglutamylprolylleucyla…
ylisoleucylthreonylasparaginyltyrosylv…
rtylvalylalanylserylalanylglutaminyltr…
lthreonylseryllysyllysyllysylserylhist…
leucylasparaginylglutamylglycylasparag…
anylarginylvalylalanylalanylglutamylas…
inylglycylprolylphenylalanylvalylgluta…
yllysylalanylleucylaspartylprolylleucy…
olyllysylaspartylleucylhistidylhistidy…
eonylglutamylvalylserylleucylvalyltryp…
larginylaspartylglycylglycylserylproly…
ylvalylglutamyltyrosylglutaminylglutam…
spartyltryptophylisoleucyllysylphenyla…
raginylleucylglutamylcysteinylvalylval…
taminylglycyllysylthreonyltyrosylargin…
ylglutamylasparaginylisoleucylvalylgly…
threonylthreonylisoleucylprolylisoleuc…
yllysylleucylvalylprolylprolylserylval…
eucylisoleucylglutamylglycylleucylvaly…
onylvalylarginylphenylalanylprolylalan…
lylprolylvalylprolylthreonylalanyllysy…
glycylserylglutamylisoleucyllysylthreo…
hreonylvalylglutamylthreonylaspartylas…
lleucylthreonylisoleucyllysylasparagin…
rtylthreonylglycylglutamyltyrosylgluta…
araginylalanylalanylglycylseryllysylth…
lthreonylvalylleucylaspartylvalylproly…
olylisoleucylasparaginylisoleucylleucy…
lhistidylmethionylthreonylisoleucylser…
ysylaspartylaspartylglycylglycylserylp…
ylisoleucylvalylglutamyllysylglutaminy…
ylthreonyltryptophylglycylvalylvalylse…
yllysylleucyllysylisoleucylprolylhisti…
inylglutamyltyrosylvalylphenylalanylar…
raginyllysylisoleucylglycylvalylglycyl…
onylprolylthreonylvalylalanyllysylhist…
lylserylprolylprolylglycyllysylprolylv…
hreonylglutamylasparaginylalanylalanyl…
lleucylprolyllysylserylaspartylglycylg…
ycyltyrosyltyrosylmethionylglutamylarg…
cyllysyltryptophylvalylarginylvalylasp…
lalanylaspartylleucyllysylphenylalanyl…
osylglutamylglycylasparaginylthreonylt…
lylphenylalanylalanylglutamylasparagin…
lprolylserylprolylserylserylaspartylpr…
ginylprolylisoleucyllysylprolylprolylg…
ylprolyllysylleucyllysylaspartyllysyls…
partylleucylvalyltryptophylthreonyllys…
ycylserylprolylisoleucylleucylglycylty…
taminyllysylprolylglycylthreonylalanyl…
nylisoleucylasparaginyllysylaspartylgl…
nylcysteinylalanylphenylalanylarginylv…
amylglycylasparaginylglutamyltyrosylar…
sylalanylalanylasparaginylisoleucylval…
larginylglutamylleucylalanylglutamylse…
lisoleucylleucylhistidylprolylprolylgl…
lylthreonylcysteinylarginylaspartylval…
lglycylglutaminylthreonylisoleucylargi…
llysylglycylarginylprolylglutamylproly…
lthreonyllysylglutamylglycyllysylvalyl…
nylvalylaspartylleucylisoleucylglutami…
glutamylleucylglutaminylisoleucyllysyl…
artylhistidylglycyllysyltyrosylisoleuc…
nylserylserylglycylhistidylalanylgluta…
lasparaginylvalylleucylaspartylarginyl…
ylasparaginylleucyllysylvalylthreonyla…
lasparaginylcysteinylthreonylisoleucyl…
rolylleucylaspartylasparaginylglycylgl…
sparaginylphenylalanylisoleucylvalylgl…
raginylglutaminyllysylglycyltryptophyl…
tylvalylthreonyllysylarginylleucylisol…
ucylalanylasparaginylasparaginylglutam…
valylcysteinylalanylglutamylasparaginy…
hreonylisoleucylglutamylthreonyllysylt…
soleucylasparaginylprolylisoleucylaspa…
ylglutamylasparaginylleucylhistidyliso…
lthreonylphenylalanylvalyltyrosylleucy…
laspartyltyrosylaspartylglycylglycylse…
sylhistidylvalylglutamylarginylarginyl…
tyltryptophylglutamylarginylvalylhisti…
utamylthreonylhistidyltyrosylmethionyl…
lutamylasparaginylglutaminylisoleucylt…
lylglutaminylthreonyllysylasparaginylg…
artyltryptophylvalyllysylthreonylgluta…
amylaspartylleucylglutaminyllysylproly…
ylserylglycylvalylleucylthreonylvalyll…
leucylarginylleucylglutamylalanylglycy…
lalanylprolylglutamylvalylalanyltrypto…
tylalanylthreonylaspartylleucylthreony…
lisoleucylaspartylthreonylarginylalany…
lserylleucylthreonyllysylalanyllysylar…
tyrosylvalylvalylthreonylalanylthreony…
ylphenylalanylvalylalanyltyrosylalanyl…
aspartyllysylprolylglycylprolylvalylar…
lvalylaspartylvalylserylserylaspartyla…
yltryptophylaspartylprolylprolylglutam…
inylglutamylisoleucylglutaminylasparag…
ysylcysteinylglutamylthreonyllysylargi…
eonyltyrosylserylalanylthreonylvalylle…
eonylvalylthreonylarginylleucylisoleuc…
tyrosylisoleucylphenylalanylarginylval…
ysylisoleucylglycylthreonylglycylproly…
olylvalylisoleucylalanyllysylthreonyll…
larginylprolylaspartylprolylprolylglut…
ylglutamylglutamylmethionylthreonylval…
rolylglutamyltyrosylaspartylglycylglyc…
tyrosylphenylalanylleucylglutamyllysyl…
onylarginyltryptophylvalylprolylvalyla…
prolylglutamylarginylarginylmethionyll…
lleucylprolylaspartylhistidylglutamylt…
valyllysylalanylglutamylasparaginylglu…
glutamylprolylserylleucylprolylserylar…
artylprolylisoleucylglutamylprolylprol…
inylphenylalanylarginylvalylvalylaspar…
ylisoleucylthreonylleucylglycyltryptop…
artylglycylglycylalanylprolylisoleucyl…
tamylmethionylarginylprolyllysylisoleu…
spartylglutamylglycyltryptophyllysylar…
ylalanylglutaminylleucylvalylarginylly…
lthreonylserylleucylaspartylglutamylas…
lutamylphenylalanylarginylvalylcystein…
inylvalylglycylisoleucylglycylarginylp…
mylalanylisoleucyllysylprolyllysylglut…
olylglutamylisoleucylaspartylleucylasp…
ylleucylvalylisoleucylvalylarginylalan…
inylleucylphenylalanylalanylisoleucylv…
lprolyllysylvalylthreonyltryptophylarg…
ylasparaginylvalylvalylarginyllysylgly…
ylaspartylthreonylmethionylalanylpheny…
paraginylserylthreonylarginylaspartyla…
leucylthreonylleucylvalylasparaginylpr…
valylphenylalanylvalylasparaginylvalyl…
rolylglycylprolylvalylserylaspartylleu…
onyllysylthreonylserylcysteinylhistidy…
olylglutamylasparaginylaspartylglycylg…
stidyltyrosylisoleucylvalylglutamyllys…
nyllysylthreonyltryptophylserylthreony…
syllysylthreonylserylphenylalanylhisti…
lylprolylglycylasparaginylglutamyltyro…
hreonylalanylvalylasparaginylglutamylt…
threonylaspartylvalylprolyllysylprolyl…
lleucylserylglutamylprolylaspartylprol…
lanylthreonylglutamylmethionylthreonyl…
leucylalanyltryptophylleucylprolylprol…
alanyllysylisoleucylaspartylglycyltyro…
ginylglutamylglutamylglutamylglutaminy…
hylthreonylglutamyltyrosylserylvalylva…
lylvalylthreonylglycylleucyllysylgluta…
ylalanylarginylvalylalanylalanylarginy…
erylleucylprolylarginylglutamylalanylg…
anyllysylglutamylglutaminylleucylleucy…
thionylprolylglutamylglutaminylisoleuc…
llysyllysylleucylarginylisoleucylgluta…
lysylprolylhistidylprolylthreonylcyste…
glutamylaspartylglutamylvalylvalylthre…
alylhistidyllysylalanylaspartylserylse…
leucyllysylaspartylvalylthreonylarginy…
osylserylleucylthreonylalanylglutamyla…
spartylthreonylglutaminyllysylisoleucy…
tylalanylprolylglycylprolylprolylgluta…
ylisoleucylserylaspartylisoleucylaspar…
ylleucylseryltryptophylhistidylisoleuc…
lglycylserylasparaginylisoleucylthreon…
lutamyllysylcysteinylaspartylvalylsery…
ylthreonylalanylleucylalanylserylvalyl…
arginylvalylglycyllysylleucylisoleucyl…
ylisoleucylphenylalanylarginylvalylarg…
lphenylalanylglycylisoleucylserylgluta…
ysylmethionylvalylalanylglutaminylphen…
ylprolylserylglutamylprolyllysylaspara…
lvalylasparaginyllysylaspartylcysteiny…
yptophylaspartylarginylprolylaspartyls…
isoleucylisoleucylglycyltyrosylleucyli…
larginylasparaginylserylleucylleucyltr…
aspartylthreonylleucylvalylarginylsery…
inylalanylglycylleucylvalylglutamylgly…
alanylarginylisoleucyltyrosylalanylleu…
lserylprolylprolylseryllysylprolylthre…
nylarginylmethionylprolylvalylaspartyl…
ylvalylisoleucylaspartylvalylthreonyll…
oleucyltryptophylalanylarginylprolylly…
llysylisoleucylisoleucylglycyltyrosylp…
inyllysylleucylprolylglycylaspartyllys…
paraginylthreonylalanylprolylhistidylg…
lutamylglutamyltyrosylthreonylalanylth…
ysylalanylglutaminyltyrosylglutaminylp…
anylarginylthreonylalanylvalylasparagi…
lutamylprolylserylaspartylprolylvalylt…
lasparaginylvalylprolylprolylarginylis…
ylmethionyllysylserylleucylleucylthreo…
paraginylvalylcysteinylleucylaspartyla…
llysylprolylmethionylprolylthreonylval…
glycylthreonylleucylleucyllysylprolyla…
thionylalanylmethionylglutaminylarginy…
leucylglutamylleucylphenylalanylserylv…
serylglycylaspartyltyrosylthreonylisol…
nylserylserylglycylseryllysylserylalan…
valylleucylaspartyllysylprolylglycylpr…
eucylasparaginyllysylmethionyltyrosyls…
eucylseryltryptophylglutamylprolylprol…
lserylglutamylisoleucylthreonylasparag…
sylarginylglutamylthreonylserylarginyl…
utaminylvalylserylalanylthreonylvalylp…
lserylvalylglutamyllysylleucylisoleucy…
sylglutaminylphenylalanylarginylisoleu…
yllysyltyrosylglycylvalylglycylasparty…
tamylprolylalanylisoleucylalanyllysyla…
ylprolylglycylarginylcysteinylaspartyl…
raginylisoleucylthreonyllysylaspartylh…
ryptophyllysylprolylprolylalanylaspart…
oleucylthreonylglycyltyrosylleucylleuc…
nylglutaminylalanylvalylasparaginyltry…
larginyllysylprolylisoleucylisoleucylg…
anylthreonylglycylleucylglutaminylglut…
utamylphenylalanylarginylvalylthreonyl…
ylglycylprolylglycyllysylprolylserylas…
yrosylalanylarginylaspartylprolylgluta…
lprolylalanylphenylalanylprolyllysylva…
rginylserylserylvalylserylleucylserylt…
osylaspartylglycylglycylserylprolyliso…
alylglutamylvalyllysylarginylalanylasp…
phylvalylarginylcysteinylasparaginylle…
ylglutaminyllysylthreonylarginylphenyl…
ucylmethionylglutamylaspartylthreonylg…
nylarginylvalyltyrosylalanylvalylaspar…
rylaspartylprolylserylaspartylvalylpro…
yllysylaspartylisoleucylleucylisoleucy…
histidylaspartylalanylaspartylleucylar…
ucylarginylalanylglycylvalylthreonylme…
lylvalyllysylglycylarginylprolylprolyl…
hylseryllysylprolylasparaginylvalylasp…
lisoleucylglycylleucylaspartylisoleucy…
anylaspartylthreonylphenylalanylleucyl…
valylasparaginyllysyltyrosylaspartylal…
ylthreonylleucylglutamylasparaginylser…
tyrosylthreonylisoleucylvalylvalyllysy…
lycylprolylprolylisoleucylasparaginylv…
ucylseryllysylaspartylserylalanyltyros…
olylprolylisoleucylisoleucylaspartylgl…
ucylasparaginyltyrosylvalylvalylglutam…
mylarginyllysylseryltryptophylserylthr…
ysteinylseryllysylthreonylserylphenyla…
eucylglutamylglutamylglycyllysylserylt…
ylvalylphenylalanylalanylglutamylaspar…
lglycylaspartylprolylglycylglutamylthr…
lalanylserylglutaminylthreonylprolylgl…
ysylvalylarginylserylvalylseryllysylse…
yltryptophyllysyllysylprolylhistidylse…
isoleucylisoleucylglycyltyrosylvalylva…
ylglutamylglutamylasparaginyllysyltryp…
yllysylserylleucylserylleucylglutaminy…
cylthreonylglutamylglycyllysylglutamyl…
alylserylalanylglutamylasparaginylglut…
threonylprolylserylglutamylisoleucylth…
ylaspartylvalylvalylalanylprolylaspart…
ucylprolylaspartylleucylcysteinyltyros…
nylserylasparaginylphenylalanylarginyl…
lysylglycyllysylprolylalanylprolylsery…
ylglutamylaspartylprolylleucylalanylth…
erylvalylglutamylserylserylalanylvalyl…
oleucylvalyltyrosylaspartylcysteinylgl…
cyllysyltyrosylthreonylisoleucylthreon…
glycylthreonyllysylglutamylglycylthreo…
lvalylglycyllysylprolylglycylisoleucyl…
lysylphenylalanylaspartylglutamylvalyl…
ylthreonylleucyllysyltryptophylalanylp…
cylglycylserylglutamylisoleucylthreony…
lutamyllysylarginylaspartylserylvalyla…
lvalylthreonylcysteinylalanylserylalan…
nylphenylalanylarginylvalylthreonylarg…
hionylglutamyltyrosylthreonylphenylala…
sparaginyllysyltyrosylglycylvalylglycy…
amylprolylisoleucylvalylalanylarginylh…
lylprolylaspartylalanylprolylprolylpro…
spartylvalylarginylhistidylaspartylser…
lthreonylaspartylprolyllysyllysylthreo…
threonylglycyltyrosylhistidylleucylglu…
ylasparaginylserylleucylleucyltryptoph…
lthreonylprolylisoleucylarginylmethion…
alylthreonylglycylleucylthreonylglutam…
ylphenylalanylarginylvalylmethionylala…
glycylvalylglycyllysylprolylserylleucy…
lalanylleucylaspartylprolylisoleucylas…
glutamylvalylisoleucylasparaginylisole…
valylthreonylleucylisoleucyltryptophyl…
spartylglycylglycylhistidyllysylleucyl…
glutamyllysylarginylaspartylleucylprol…
llysylalanylasparaginylhistidylvalylas…
ylalanylphenylalanylthreonylvalylthreo…
lglycyllysyltyrosylglutamylphenylalany…
asparaginylthreonylalanylglycylalanyli…
mylserylthreonylglutamylthreonylisoleu…
lutamyltyrosylglutamylalanylprolylthre…
lylthreonylisoleucyllysylaspartylglycy…
glycylaspartylthreonylisoleucylvalylle…
isoleucylleucylglycyllysylprolylleucyl…
llysylalanylglycyllysylaspartylisoleuc…
ylthreonylglutaminylisoleucylthreonyls…
lmethionylleucylthreonylisoleucyllysyl…
partylalanylglycylglutamyltyrosylthreo…
sparaginylprolylphenylalanylglycylthre…
lysylvalylthreonylvalylleucylaspartylv…
rolylvalylglutamylisoleucylserylaspara…
lanylthreonylleucylthreonyltryptophylt…
partylglycylglycylserylprolylisoleucyl…
tamyllysylarginylglutamylthreonylseryl…
ylvalylvalylserylglutamylaspartylisole…
histidylvalylalanylthreonyllysylleucyl…
lglutamyltyrosylisoleucylphenylalanyla…
nylhistidyltyrosylglycyllysylglycylglu…
amylprolylvalyllysylmethionylvalylaspa…
prolylglycylprolylprolylglutamyllysylp…
alylthreonyllysylasparaginylthreonylal…
ylarginylprolylvalylaspartylaspartylgl…
eonylglycyltyrosylhistidylvalylglutamy…
rylleucylarginyltryptophylvalylarginyl…
alylserylaspartylleucylarginylcysteiny…
aminylglutamylglycylserylthreonyltyros…
erylalanylglutamylasparaginylarginylal…
ylserylglutamylalanylserylaspartylsery…
lanylalanyltyrosylprolylprolylglycylpr…
tidylvalylthreonylaspartylthreonylthre…
lalanyltryptophylglycyllysylprolylhist…
ylglutamylisoleucylthreonylglycyltyros…
nyllysylvalylglycylaspartylglutamylala…
threonylthreonylglycylthreonylalanylle…
nylphenylalanylvalylvalylprolylasparty…
myllysyltyrosylasparaginylphenylalanyl…
lasparaginylaspartylalanylglycylvalylg…
ucylprolylaspartylvalylglutamylisoleuc…
onylalanylprolylaspartylphenylalanylgl…
eucylarginylarginylthreonylleucylvalyl…
isoleucylarginylisoleucylphenylalanylv…
ylprolylalanylprolylglutamylvalylthreo…
sparaginylisoleucylasparaginylleucylly…
nylisoleucylglutamylasparaginylthreony…
eucylleucylisoleucylisoleucylprolylglu…
osylaspartylthreonylglycyllysylphenyla…
lglutamylasparaginylprolylalanylglycyl…
lylasparaginylvalylarginylvalylleucyla…
lylleucylasparaginylleucylarginylproly…
ysylaspartylserylvalylthreonylleucylhi…
lleucylisoleucylaspartylglycylglycylse…
nyltyrosylisoleucylvalylglutamyllysyla…
lysylseryltyrosylserylthreonylalanylth…
llysylcysteinylthreonyltyrosyllysylval…
glycylcysteinylglutamyltyrosylphenylal…
ylalanylglutamylasparaginylglutamyltyr…
olylthreonylglutamylthreonylthreonylgl…
utamylalanylprolylserylprolylprolylasp…
lmethionylaspartylisoleucylthreonyllys…
yltryptophylprolyllysylprolyllysylhist…
soleucylthreonylglycyltyrosylvalylisol…
llysylglycylserylaspartylglutaminyltry…
eonylthreonylvalyllysylglycylleucylglu…
raginylleucylthreonylglutamylglycylglu…
lanylglutaminylvalylmethionylalanylval…
ylserylalanylprolylarginylglutamylsery…
sylglutamylglutaminylthreonylmethionyl…
eucylarginylglycylisoleucyltyrosylglut…
yllysylalanylglycylaspartylasparaginyl…
lprolylvalylleucylglycylarginylprolyll…
tophyllysyllysylglycylaspartylglutamin…
eonylglutaminylarginylvalylasparaginyl…
lalanylthreonylserylthreonylisoleucyll…
lglutamylcysteinylvalylarginylserylasp…
leucylthreonylalanylarginylasparaginyl…
ycylaspartylvalylisoleucylthreonylisol…
lisoleucylprolylglycylprolylprolylthre…
lalanylaspartylglutamylvalylserylseryl…
enylalanylseryltryptophylaspartylproly…
lycylglycylvalylprolylisoleucylserylas…
ethionylarginylglutaminylthreonylaspar…
alylglutamylleucylalanylthreonylthreon…
onyltyrosyllysylalanylthreonylarginyll…
utamyltyrosylglutaminylphenylalanylarg…
aginylarginyltyrosylglycylvalylglycylp…
anyltryptophylisoleucylvalylalanylaspa…
ylvalylprolylglycylprolylprolylglycylt…
lalanylvalylthreonyllysylaspartylseryl…
tophylhistidylglutamylprolylleucylsery…
leucylleucylglycyltyrosylhistidylvalyl…
asparaginylglycylisoleucylleucyltrypto…
ylalanylleucylvalylprolylglycylasparag…
serylglycylleucylthreonylaspartylglycy…
ylalanylarginylvalylisoleucylalanylglu…
yllysylseryllysylprolylseryllysylproly…
alanylleucylaspartylprolylisoleucylasp…
alylprolylleucylasparaginylisoleucylth…
hreonylleucyllysyltryptophylalanyllysy…
lglycylphenylalanyllysylisoleucylthreo…
yllysylarginylaspartylleucylprolylaspa…
llysylalanylasparaginylphenylalanylser…
lasparaginylglutamylphenylalanylthreon…
tamylaspartylalanylalanyltyrosylglutam…
alanyllysylasparaginylalanylalanylglyc…
erylglutamylprolylserylaspartylalanyli…
artylaspartylvalylglutamylalanylprolyl…
yllysylphenylalanyllysylaspartylthreon…
ycylglutamylalanylphenylalanylarginyll…
ylglycylarginylprolylprolylprolylthreo…
lysylaspartylglycyllysylglutamylleucyl…
ucylglutamylisoleucyllysylisoleucylala…
lasparaginylleucylvalylasparaginyllysy…
laspartylserylglycylalanyltyrosylthreo…
raginylprolylglycylglycylphenylalanyla…
anylasparaginylvalyllysylvalylleucylas…
ylglutamylglycylprolylleucylalanylvaly…
glutamyllysylcysteinylvalylleucylseryl…
eucylaspartylaspartylglycylglycylalany…
sylisoleucylvalylglutaminyllysylarginy…
alanyltryptophylthreonylasparaginylval…
lvalylthreonyllysylleucyllysylvalylthr…
paraginylglutamyltyrosylisoleucylpheny…
alylasparaginyllysyltyrosylglycylvalyl…
erylglutamylprolylvalylleucylalanylval…
lylprolylaspartylprolylprolyllysylaspa…
hreonylisoleucylthreonyllysylaspartyls…
ptophylglycylhistidylprolylaspartylser…
isoleucylisoleucylasparaginyltyrosylis…
spartyllysylalanylglycylglutaminylargi…
lasparaginyllysyllysylthreonylleucylth…
ysylvalylserylglycylleucylthreonylglut…
utamylphenylalanylarginylisoleucylmeth…
lalanylglycylisoleucylserylalanylproly…
ylalanyltyrosyllysylalanylcysteinylasp…
prolylglycylprolylprolylglycylasparagi…
threonylserylarginylserylserylisoleucy…
raginyllysylprolylisoleucyltyrosylaspa…
cylthreonylglycyltyrosylmethionylvalyl…
glutamylglutamylaspartylglutamyltrypto…
lprolylprolylalanylglycylleucyllysylal…
leucylthreonylglycylleucylthreonylglut…
rosyllysylisoleucylarginylisoleucyltyr…
glutamylglycylleucylglycylglutamylprol…
onylprolyllysylalanylglutamylaspartyla…
utamylisoleucylglutamylleucylaspartyla…
lvalylthreonylisoleucylarginylalanylcy…
ylleucylphenylalanylvalylprolylisoleuc…
rolylglutamylvalyllysyltryptophylalany…
mylserylleucylaspartyllysylalanylseryl…
ryltyrosylthreonylleucylleucylisoleucy…
inylarginylphenylalanylaspartylserylgl…
onylvalylglutamylasparaginylserylseryl…
anylvalylasparaginylvalylarginylvalyll…
olylprolylglutaminylaspartylleucyllysy…
ylthreonylserylvalylthreonylleucylthre…
eucylleucylaspartylglycylglycylserylly…
isoleucylvalylglutamyllysylarginylglut…
tyrosylserylthreonylvalylalanylthreony…
hreonylseryltryptophyllysylvalylaspart…
lglycylcysteinylseryltyrosyltyrosylphe…
utamylasparaginylglutamyltyrosylglycyl…
utamylthreonylalanylglutamylserylvalyl…
ylleucylprolylprolylglycyllysylisoleuc…
lylthreonylarginylasparaginylserylvaly…
lysylprolylglutamylhistidylaspartylgly…
lglycyltyrosylisoleucylvalylglutamylme…
lserylaspartyllysyltryptophylalanylthr…
sylvalylthreonylglutamylalanylthreonyl…
cylglutaminylglycylglutamylglutamyltyr…
rylalanylglutaminylasparaginylglutamyl…
olylarginylglutaminylleucylserylvalylp…
tylleucylvalylisoleucylprolylprolylala…
nylalanylasparaginylthreonylphenylalan…
utamylaspartylleucyllysylvalylaspartyl…
cylarginylprolylthreonylprolylalanylva…
spartylasparaginylvalylprolylleucyllys…
valylasparaginylalanylglutamylserylthr…
serylleucylleucylthreonylisoleucyllysy…
amylaspartylvalylglycylhistidyltyrosyl…
ginylserylalanylglycylglutamylalanylis…
ginylvalylisoleucylvalylleucylaspartyl…
ylglycylprolylvalyllysylmethionylaspar…
tylserylisoleucylthreonylleucylseryltr…
sylaspartylglycylglycylserylserylisole…
oleucylvalylglutamyllysylarginylaspart…
onyltryptophylglutaminylisoleucylvalyl…
ylthreonylthreonylisoleucyllysylalanyl…
glycylcysteinylglutamyltyrosylglutamin…
lalanylglutamylasparaginylarginyltyros…
ucylasparaginylserylglutamylprolylthre…
lylphenylalanyllysylvalylprolylglycylp…
lvalylthreonylleucylserylserylarginyla…
lutaminyltryptophylasparaginylglutamyl…
lycylserylarginylvalylisoleucylglycylt…
lysylglutamylarginylasparaginylserylis…
ucylasparaginyllysylthreonylprolylisol…
henylalanyllysylthreonylthreonylglycyl…
utamyltyrosylglutamylphenylalanylargin…
ylisoleucylvalylglycylisoleucylglycyll…
mylcysteinyltyrosylvalylalanylarginyla…
lprolylglycylarginylprolylglutamylalan…
ginylasparaginylserylvalylthreonylleuc…
lylthreonyltyrosylaspartylglycylglycyl…
rosylisoleucylvalylglutamyllysyllysylg…
ginyltryptophylmethionyllysylalanylser…
oleucylisoleucylaspartylthreonylhistid…
glycylleucylvalylglutamylaspartylhisti…
ylarginylvalylisoleucylalanylarginylas…
nylalanylserylglutamylprolylserylgluta…
ylthreonylalanylarginylaspartylglutamy…
oleucylserylmethionylaspartylprolyllys…
ucylvalylvalylhistidylalanylglycylglut…
rtylalanylaspartylisoleucyltyrosylglyc…
lisoleucylglutaminyltryptophylisoleucy…
mylleucylserylasparaginylthreonylalany…
lserylthreonylaspartylphenylalanylalan…
laspartylalanylvalylarginylvalylaspart…
eucylleucyllysylalanyllysylasparaginyl…
ylvalylthreonylvalylasparaginylvalylly…
glycylprolylprolylglutamylglycylprolyl…
threonylalanylglutamyllysylcysteinylth…
olylprolylleucylglutaminylaspartylglyc…
ucylasparaginyltyrosylisoleucylvalylgl…
lserylarginylleucylvalyltryptophylthre…
inylvalylglutaminylthreonylleucylseryl…
cylleucylglutamylglycylasparaginylglut…
nylisoleucylmethionylalanylvalylaspara…
lutamylprolylleucylglutamylserylglutam…
ginylprolylphenylalanylvalylvalylproly…
lylglutamylvalylthreonylthreonylvalylt…
soleucylvalylvalyltryptophylglutamylar…
lglycylserylglutamylisoleucylleucylgly…
rginylaspartyllysylglutamylglycylisole…
lcysteinylhistidyllysylarginylleucylis…
eucylarginylvalylthreonylglycylleucyli…
aspartyltyrosylglutamylphenylalanylarg…
inylalanylalanylglycylleucylserylgluta…
yltyrosylglutaminyllysylalanylcysteiny…
lprolylglycylprolylprolylasparaginylas…
spartylisoleucylthreonylarginylserylse…
tophylseryllysylprolylisoleucyltyrosyl…
ylisoleucylglutaminylglycyltyrosylisol…
artylvalylasparaginylvalylglycylglutam…
nylthreonylprolylprolylthreonylglycyli…
araginylisoleucylglutamylvalylglutamyl…
dylglutamyltyrosylasparaginylphenylala…
soleucylasparaginyllysylalanylglycylva…
rtylvalylprolylglycylprolylisoleucylis…
ucylglutamylalanylprolylaspartylisoleu…
amylleucylarginyllysylisoleucylisoleuc…
glycylglycylserylleucylarginylleucylph…
glycylarginylprolylthreonylprolylgluta…
alylaspartylglycylglutamylisoleucylarg…
oleucylaspartylvalylthreonylserylseryl…
lleucylaspartylasparaginylvalylasparag…
yllysyltyrosylthreonylleucylthreonylle…
ycylthreonyllysylserylalanylphenylalan…
cylaspartylthreonylprolylserylprolylpr…
lthreonylglutamylisoleucylthreonyllysy…
reonyltryptophylglutamylprolylprolylle…
lysylisoleucyllysylasparaginyltyrosyli…
utamylalanylthreonylarginyllysylserylt…
lasparaginylcysteinylhistidyllysylaspa…
laspartylglutaminylleucylglutaminylglu…
osylphenylalanylarginylvalylthreonylal…
sylglycylisoleucylglycylleucylprolylal…
lprolylisoleucyllysylvalylalanylglutam…
glycyllysylisoleucylthreonylvalylaspar…
raginylserylvalylserylleucylseryltrypt…
tidylaspartylglycylglycylseryllysyliso…
leucylvalylglutamylmethionylglutaminyl…
yltryptophylserylglutamylcysteinylalan…
minylalanylvalylisoleucylthreonylaspar…
lglutamylglutamyltyrosylleucylphenylal…
araginylglutamyllysylglycylarginylsery…
anylvalylprolylisoleucylvalylalanyllys…
mylprolylaspartylvalyllysylprolylalany…
valylglutaminylvalylglycylglutaminylas…
alylprolylisoleucylserylglycylarginylp…
reonyltryptophylthreonyllysylaspartylg…
nylthreonylthreonylarginylisoleucylasp…
eucylaspartylleucylthreonylthreonylleu…
nylhistidyllysylaspartylaspartylglycyl…
cylthreonylvalylalanylasparaginylvalyl…
lanylserylisoleucylglutamylisoleucylva…
laspartylprolylprolyllysylglycylprolyl…
tylvalylserylalanylglutamylserylisoleu…
araginylprolylprolylleucyltyrosylthreo…
soleucylthreonylasparaginyltyrosylisol…
artylthreonylthreonylthreonylthreonylv…
ylalanylthreonylvalylalanylarginylthre…
llysylleucyllysylthreonylglycylthreony…
nylarginylisoleucylphenylalanylalanylg…
cylglutaminylserylphenylalanylalanylle…
eucylvalylalanylglutaminyltyrosylproly…
olylprolylglycylthreonylprolylphenylal…
ryllysylaspartylserylmethionylvalyliso…
lutamylprolylvalylasparaginylasparagin…
ucylglycyltyrosylhistidylleucylglutamy…
inylserylisoleucylleucyltryptophylthre…
nylisoleucylisoleucylhistidylaspartylt…
lanylglutaminylasparaginylleucylglutam…
rosylglutamylphenylalanylarginylvalylt…
eucylvalylglycylvalylglycyllysylalanyl…
ysteinyltyrosylvalylalanylarginylaspar…
lylglycylthreonylprolylglutamylprolyli…
sparaginylglutamylisoleucylthreonylleu…
lprolylvalyltyrosylaspartylglycylglycy…
cyltyrosylisoleucylvalylglutamyllysyla…
lycylarginyltryptophylmethionyllysylal…
ginylvalylisoleucylglutamylthreonylglu…
ylglycylleucylthreonylglutamylaspartyl…
nylalanylarginylvalylisoleucylalanylly…
nylisoleucylseryllysylprolylserylaspar…
ylthreonylalanyllysylaspartylglutamylv…
eucylserylmethionylaspartylprolyllysyl…
isoleucylvalylvalylasparaginylalanylgl…
inylleucylglutamylalanylaspartylvalylh…
lthreonylisoleucylglutamyltryptophylle…
mylisoleucylglutamylglutamylserylalany…
ysylasparaginylthreonylaspartylphenyla…
ylvalyllysylaspartylalanylisoleucylarg…
utaminyltyrosylisoleucylleucylarginyla…
cylseryllysylserylphenylalanylprolylva…
aspartylarginylprolylglycylprolylproly…
lvalylthreonylglycylvalylthreonylseryl…
reonyltryptophylserylprolylprolylleucy…
laspartylisoleucylserylhistidyltyrosyl…
mylthreonylserylarginylleucylalanyltry…
lglutamylvalylvalylthreonylasparaginyl…
eucylleucylglutamylglycylasparaginylgl…
ylisoleucylmethionylalanylvalylasparag…
utamylprolylleucylglutamylserylalanylp…
aginylprolylphenylalanylvalylleucylpro…
ylglutamylvalylthreonylasparaginylisol…
nylthreonylvalylcysteinyltryptophylasp…
spartylglycylglycylserylglutamylisoleu…
alylglutamyllysylarginylaspartylarginy…
hylisoleucyllysylcysteinylasparaginyll…
aspartylleucylarginylleucylarginylvaly…
ylaspartylhistidylglutamyltyrosylgluta…
nylglutamylasparaginylalanylalanylglyc…
lylalanylthreonylvalyltyrosyltyrosylly…
ylphenylalanyllysylprolylglycylprolylp…
dylisoleucylvalylaspartylthreonylthreo…
reonylleucylalanyltryptophylglycyllysy…
ylglycylserylglutamylisoleucylleucylgl…
cylcysteinyllysylalanylaspartylglutamy…
ylisoleucylvalylthreonylprolylglutamin…
hreonylarginylphenylalanylglutamylisol…
ylhistidylglutaminylglutamyltyrosyllys…
nylleucylasparaginyllysylvalylglycylle…
ylvalylprolylglycylthreonylvalyllysylp…
tamylalanylprolylglutamylleucylasparty…
rginyllysylglycylisoleucylvalylvalylar…
rginylisoleucylhistidylisoleucylprolyl…
lmethionylprolylglutamylisoleucylthreo…
utamylglycylglutamylphenylalanylthreon…
ucylglutamyllysylglycylvalylasparaginy…
ylisoleucylaspartylasparaginylcysteiny…
alanylglycyllysyltyrosylisoleucylleucy…
lserylglycylseryllysylserylalanylpheny…
leucylaspartylthreonylprolylglycylprol…
alanylvalyllysylglutamylvalylarginylly…
eucylvalyltryptophylglutamylprolylprol…
lycylalanyllysylvalyllysylasparaginylt…
ginylglutamylserylthreonylarginyllysyl…
serylseryllysylcysteinylseryllysylthre…
amylasparaginylleucylthreonylglutamylg…
henylalanylarginylvalylmethionylalanyl…
anylglycylvalylglycylvalylprolylvalylg…
alyllysylalanylalanylglutamylprolylpro…
lthreonylleucylthreonylaspartylvalylse…
ylleucylmethionyltryptophylglutamyllys…
cylglycylserylarginylvalylleucylglycyl…
lutaminylprolyllysylglycylthreonylglut…
lylalanylglutamylseryllysylvalylcystei…
nylglycylleucylserylserylglycylglutami…
lanylarginylvalyllysylalanyltyrosylasp…
ylaspartylprolylarginylvalylleucylglyc…
sylaspartylleucylthreonylisoleucylglut…
rolylphenylalanylasparaginylthreonylty…
glycylglutamylaspartylleucyllysylisole…
leucylglycylarginylprolylarginylprolyl…
valyllysylaspartylglycylglutamylprolyl…
ylarginylvalylasparaginylvalylglutamyl…
threonylvalylleucylhistidylisoleucylly…
partylaspartylphenylalanylglycyllysylt…
reonylasparaginylserylalanylglycylthre…
ylleucylserylvalylisoleucylvalylleucyl…
ylvalylglycylprolylvalylarginylphenyla…
ylaspartylphenylalanylvalylvalylisoleu…
lylalanyltyrosylthreonylglycylglycylcy…
raginyltyrosylisoleucylvalylglutamylly…
hreonylthreonylthreonyltryptophylhisti…
lvalylalanylarginylthreonylthreonyliso…
ucyllysylthreonylglycylthreonylglutamy…
ylisoleucylphenylalanylalanylglutamyla…
serylalanylprolylleucylaspartylserylly…
nyltyrosylprolylphenylalanyllysylgluta…
reonylprolylphenylalanylvalylthreonyls…
aminylmethionylleucylvalylglutaminyltr…
asparaginylaspartylglycylglycylthreony…
ylhistidylleucylglutamylglutaminyllysy…
ucylleucyltryptophylvalyllysylleucylas…
ylglutaminylaspartylthreonyllysylpheny…
eucylaspartylglutamylglycylleucylgluta…
valylserylalanylglutamylasparaginyliso…
ylprolylseryllysylvalylserylglutamylcy…
ylaspartylprolylcysteinylaspartylproly…
lanylisoleucylvalylisoleucylthreonylar…
eonylleucyllysyltryptophyllysyllysylpr…
ylseryllysylisoleucylthreonylglycyltyr…
laspartylleucylprolylaspartylglycylarg…
erylphenylalanylthreonylasparaginylval…
nylalanylthreonylvalylserylglycylleucy…
inyltyrosylglutamylphenylalanylarginyl…
nylalanylalanylglycylasparaginylphenyl…
tylserylserylglycylalanylisoleucylthre…
oleucylaspartylalanylprolylasparaginyl…
ltyrosyllysylaspartylvalylisoleucylval…
threonylphenylalanylvalylleucylglutamy…
yllysylprolylisoleucylprolylaspartylva…
lglycyllysylglutamylleucylglutamylglut…
ionylglutamylisoleucyllysylserylthreon…
hreonylleucylvalylvalyllysylaspartylcy…
rtylglycylglycylglutaminyltyrosylisole…
ylvalylglycylglycylthreonyllysylseryli…
llysylvalylleucylaspartylarginylprolyl…
ylleucyllysylvalylthreonylglycylvalylt…
tyrosylleucylalanyltryptophylasparagin…
tylglycylglycylalanylasparaginylisoleu…
leucylglutamyllysylarginylglutamylthre…
ylthreonylglutaminylvalylserylthreonyl…
asparaginyltyrosyllysylvalylthreonylly…
nylglutamyltyrosylisoleucylphenylalany…
paraginyllysyltyrosylglycylisoleucylgl…
ylglycylprolylvalylthreonylalanylcyste…
olylprolylglycylprolylprolylserylthreo…
oleucylthreonyllysylaspartylserylmethi…
nylarginylprolylvalylaspartylaspartylg…
lglutamylglycyltyrosylisoleucylleucylg…
tamylglycylvalylarginyltryptophylthreo…
sylthreonylleucylthreonylaspartylleucy…
lycylleucylthreonylglutamylglycylhisti…
arginylvalylalanylalanylglutamylaspara…
lutamylprolylserylglutamylprolylserylv…
lcysteinylaspartylalanylleucyltyrosylp…
sparaginylprolyllysylvalylthreonylaspa…
alylserylleucylalanyltryptophylserylly…
ycylglycylalanylprolylvalyllysylglycyl…
glutamylalanylalanylalanylaspartylglut…
inylthreonylprolylprolylthreonylglycyl…
ylphenylalanylthreonylvalylthreonyllys…
eonylglutamyltyrosylasparaginylphenyla…
lisoleucylasparaginylserylglutamylglyc…
reonylleucylprolylglycylserylvalylvaly…
leucylglutamylprolylprolylglutamylisol…
partylleucylarginyllysylvalylvalylvaly…
onylleucylarginylleucylphenylalanylval…
ylprolylglutamylprolylglutamylvalyllys…
amylglycylisoleucylleucylthreonylaspar…
glutamylvalylthreonylserylserylphenyla…
oleucylaspartylasparaginylvalylthreony…
ycylarginyltyrosylasparaginylleucylthr…
aginylserylglycylseryllysylthreonylala…
larginylvalylleucylaspartylserylprolyl…
ucylthreonylisoleucylarginylglutamylva…
onylleucylseryltryptophylglutamylproly…
lglycylalanyllysylisoleucylthreonylasp…
yllysylarginylglutamylthreonylthreonyl…
onylisoleucylthreonylasparaginylaspara…
threonylphenylalanylarginylisoleucylgl…
utamylglycylcysteinylseryltyrosyltyros…
nylserylasparaginylglutamyltyrosylglyc…
glutamylthreonylthreonylglutamylprolyl…
rolylleucylprolylprolylglycylarginylva…
threonylarginylasparaginylthreonylalan…
lutamyllysylprolylglutamylserylasparty…
eonylglycyltyrosylvalylvalylglutamylme…
lserylglutamyllysyltryptophylserylthre…
llysylthreonylleucylglutamylalanylthre…
nylalanylglycylglutamylglutamyltyrosyl…
alanylvalylasparaginylglutamyllysylgly…
lglutaminylleucylglycylvalylprolylvaly…
eucylglutamylisoleucyllysylprolylseryl…
ylhistidylthreonylphenylalanylasparagi…
lutaminylleucyllysylisoleucylaspartylv…
ginylprolylglutaminylalanylthreonylval…
aspartylglycylglutaminylthreonylleucyl…
lvalylasparaginylvalylserylserylseryll…
lserylisoleucyllysylglutamylalanylsery…
reonyltyrosylglutamylleucylcysteinylva…
lserylisoleucylthreonylvalylprolylisol…
lleucylaspartylarginylprolylglycylprol…
lisoleucylaspartylglutamylvalylserylcy…
ylisoleucylseryltryptophylasparaginylp…
lycylglycylcysteinylglutaminylisoleucy…
lylglutamyllysyllysylglutamylthreonylt…
hylhistidylisoleucylvalylserylglutamin…
erylisoleucyllysylisoleucylvalylarginy…
lutamyltyrosylglutaminylphenylalanylar…
paraginylarginyltyrosylglycyllysylsery…
lalanylvalylvalylalanylglutamyltyrosyl…
glycylprolylprolylglycylthreonylprolyl…
yllysylserylthreonylmethionylleucylval…
prolylvalylasparaginylaspartylglycylgl…
ltyrosylhistidylleucylglutamyltyrosyll…
cylleucyltryptophylseryllysylalanylasp…
ylalanylaspartylthreonylglutaminylvaly…
lglutamylglycylleucylmethionyltyrosylg…
anylglutamylasparaginylisoleucylalanyl…
seryllysylserylcysteinylglutamylprolyl…
lylcysteinylaspartylprolylprolylglycyl…
ylasparaginylisoleucylthreonylarginyll…
ophylseryllysylprolylhistidyltyrosylas…
cylthreonylglycyltyrosylisoleucylvalyl…
lprolylaspartylglycylarginyltryptophyl…
sylthreonylasparaginylisoleucylglutami…
nylglutamylvalylthreonylglutamylleucyl…
rginyltyrosylglutamylphenylalanylargin…
araginylalanylalanylaspartylserylvalyl…
ylthreonylglycylprolylisoleucylisoleuc…
utamylprolylprolylarginylvalylmethiony…
lanylarginylaspartylvalylisoleucylvaly…
lleucyllysylisoleucylasparaginylalanyl…
lprolylleucylprolylvalylisoleucylseryl…
isoleucylglutamylisoleucylglutamylglut…
tamylisoleucylisoleucylserylthreonylas…
ucylleucylthreonylvalyllysylaspartylcy…
tylthreonylglycylglutaminyltyrosylvaly…
ylvalylalanylglycylthreonylarginylsery…
yllysylvalylleucylaspartyllysylprolylg…
leucylglutamylisoleucylasparaginylglyc…
cysteinylserylleucylseryltryptophylgly…
spartylglycylglycylalanylaspartylisole…
rginyllysyllysylarginylglutamylthreony…
lthreonylisoleucylcysteinylglutamylgly…
lthreonylserylcysteinyllysylvalylthreo…
raginylglutamyltyrosylisoleucylphenyla…
lasparaginyllysyltyrosylglycylvalylgly…
lvalylalanylisoleucyllysylalanylleucyl…
alylprolylserylprolylprolylthreonylser…
rylvalylthreonyllysylglutamylserylmeth…
hylserylarginylprolylglutamylserylaspa…
cylserylglycyltyrosylisoleucylisoleucy…
lasparaginylserylleucylarginyltryptoph…
lysylprolylvalyltyrosylaspartylleucyla…
leucylarginylglutamylglycylcysteinylgl…
valyltyrosylalanylglutamylasparaginyla…
rolylserylglutamylthreonylserylprolyll…
aspartylprolylvalylphenylalanylleucylp…
lyllysylisoleucylvalylaspartylserylgly…
reonylisoleucylalanyltryptophylvalylly…
glycylglycylalanylprolylisoleucylthreo…
yltyrosyllysyllysylserylaspartylaspart…
reonylserylisoleucylglutaminylserylleu…
osylthreonylisoleucylserylglycylleucyl…
ltyrosylvalylphenylalanylarginylvalyll…
glycylalanylserylaspartylprolylserylas…
minylisoleucylalanyllysylglutamylargin…
cylphenylalanylaspartylisoleucylaspart…
lthreonylleucylisoleucylvalyllysylalan…
onylmethionylthreonylvalylprolylphenyl…
ylprolylasparaginylvalylleucyltryptoph…
spartylleucylarginylthreonylarginylala…
onylaspartylserylarginylthreonylseryll…
aginylalanylasparaginylarginylasparagi…
hreonylleucylthreonylisoleucylglutamin…
alanylserylleucylthreonylleucylvalylva…
prolylglycylprolylprolylthreonylaspara…
ylaspartylvalylthreonyllysylglutamylse…
aspartylvalylprolylglutamylasparaginyl…
yllysylasparaginyltyrosylhistidylisole…
nylseryllysyllysylalanyltryptophylvaly…
aginylcysteinylasparaginylarginylleucy…
raginylleucylglutaminylglutamylglycyla…
lanylarginylvalylserylglycylglutamylas…
valylglycylisoleucylprolylalanylglutam…
ysylisoleucylthreonylglutamyllysylprol…
cylglycylvalylthreonylserylisoleucylse…
ylthreonyltryptophylleucyllysylprolylg…
serylarginylisoleucylvalylhistidyltyro…
utamyllysylglycylglutaminyllysylaspara…
lanylvalylalanyllysylserylthreonylhist…
ucylarginylglutamylasparaginylserylglu…
larginylvalylphenylalanylalanylglutamy…
eucylserylaspartylprolylarginylglutamy…
lisoleucyllysylglutamylglutaminylleucy…
cylaspartylmethionyllysylasparaginylph…
ylvalyltyrosylvalylarginylalanylglycyl…
artylisoleucylprolylisoleucylserylglyc…
threonylleucylserylarginylaspartylglyc…
nylmethionylarginylphenylalanylasparag…
ylalanylglutamylasparaginylleucylthreo…
lutamylserylvalylthreonylalanylasparty…
isoleucylthreonylalanylalanylasparagin…
ysylalanylphenylalanylisoleucylasparag…
ylarginylprolylglycylprolylprolylthreo…
erylaspartylisoleucylthreonylglutamylg…
ltryptophylglutamylprolylprolyllysylty…
minylvalylthreonylasparaginyltyrosylis…
amylthreonylserylthreonylalanylvalyltr…
lanylthreonylvalylalanylarginylthreony…
nyllysylleucylthreonylthreonylglycylgl…
ylalanylarginylisoleucyllysylalanylglu…
glycylisoleucylserylaspartylhistidylis…
valylthreonylvalyllysylleucylprolyltyr…
lylprolylserylthreonylprolyltryptophyl…
ylarginylglutamylserylisoleucylthreony…
mylprolylvalylserylasparaginylglycylgl…
sylhistidylleucylglutamylmethionyllysy…
leucylleucyltryptophylglutaminyllysyla…
leucylarginylthreonylthreonylhistidylp…
ylisoleucylserylalanylglycylleucylisol…
inylvalyltyrosylalanylglutamylasparagi…
ylprolylserylhistidylprolylserylglutam…
spartylalanylcysteinylglutamylprolylpr…
soleucylthreonylaspartylisoleucylseryl…
ylseryltryptophylglutaminylglutaminylp…
ylglycylseryllysylisoleucylthreonylgly…
inylarginylaspartylleucylprolylasparty…
ylalanylserylphenylalanylthreonylaspar…
glutaminylphenylalanylthreonylisoleucy…
lasparaginylserylglutaminyltyrosylglut…
lanylalanylarginylasparaginylalanylval…
nylprolylserylglutamylvalylvalylglycyl…
leucylaspartylseryltyrosylglycylglycyl…
rolylleucylglutamyltyrosylthreonylglut…
anylglycylthreonylserylvalyllysylleucy…
lycyllysylprolylalanylprolylthreonylis…
ylaspartylaspartyllysylglutamylleucylg…
eucylvalylcysteinylvalylglutamylaspara…
alanylserylisoleucylleucylisoleucyllys…
ylasparaginylserylglycylcysteinyltyros…
sparaginylalanylmethionylalanylserylal…
inylvalylglutaminylisoleucylleucylaspa…
ycylglycylprolylisoleucylglutamylpheny…
anylglutamyllysylisoleucylthreonylleuc…
ylalanylaspartylaspartylglycylglycylal…
yrosylisoleucylvalylglutamyllysylargin…
valyltryptophylserylmethionylvalylsery…
amylcysteinylisoleucylisoleucylthreony…
eucyllysylglycylasparaginylglutamyltyr…
ylarginylalanylvalylasparaginyllysylty…
rolylleucylglutamylserylaspartylserylv…
ylphenylalanylvalylthreonylprolylglycy…
lutamylvalylthreonyllysylisoleucylthre…
hreonylvalylvalyltryptophylserylarginy…
lglycylserylaspartylisoleucylserylglyc…
lysylarginylaspartyllysyllysylserylleu…
lvalylleucyllysylglutamylthreonylisole…
lutaminyllysylvalylthreonylglycylleucy…
partyltyrosylglutaminyltyrosylarginylv…
alanylalanylglycylglutaminylglycylprol…
rylglutamylphenylalanyltyrosyllysylala…
artylprolylprolylglycylprolylprolylala…
anylaspartylserylthreonyllysylserylser…
tophylseryllysylprolylvalyltyrosylaspa…
eonylglycyltyrosylvalylvalylglutamylis…
mylglutamylglutamylglutamyltryptophylt…
sylglycylglutamylvalylarginylthreonylt…
ylasparaginylleucyllysylprolylglycylva…
lanylarginylvalylserylalanylvalylaspar…
ylglycylglutamylprolylisoleucylglutamy…
valylglutaminylalanyllysylaspartylisol…
amylisoleucylaspartylleucylaspartylval…
alylisoleucylalanyllysylalanylglycylgl…
eucylisoleucylprolylphenylalanyllysylg…
nylvalylthreonyltryptophylarginyllysyl…
cylglycylserylaspartylalanylarginyltyr…
ylthreonylaspartylserylserylserylleucy…
minylvalylthreonylarginylasparaginylas…
leucylleucylthreonylisoleucylglutamyla…
prolyllysylserylserylthreonylvalylsery…
nylprolylalanylalanylcysteinylglutamin…
stidylvalylserylarginylglycylthreonylv…
spartylprolylprolylleucylisoleucylaspa…
lisoleucylasparaginyltyrosylvalylisole…
nylthreonyllysylarginylthreonyltryptop…
lcysteinylserylserylthreonylserylpheny…
leucylserylglutamyllysylthreonylprolyl…
larginylvalylleucylalanylglutamylaspar…
cylglycylglutamylprolylcysteinylglutam…
yllysylalanylalanylglutamylvalylprolyl…
lleucylserylmethionyllysylaspartylsery…
leucylleucylseryltryptophylthreonyllys…
lglycylglycylserylvalylisoleucylthreon…
arginyllysylglycyllysylglycylglutamylg…
tidylalanylglycylisoleucylseryllysylth…
tamylvalylserylglutaminylleucyllysylgl…
tamylphenylalanylarginylvalylphenylala…
sylglycylleucylserylaspartylprolylvaly…
ucylthreonylvalyllysylglutamylleucylis…
mylvalylaspartylleucylserylaspartyliso…
alylthreonylvalylarginylisoleucylglycy…
ucylglutamylleucylprolyltyrosyllysylgl…
eucylseryltryptophylleucyllysylasparty…
mylserylglutamylphenylalanylvalylargin…
tamylasparaginyllysylisoleucylthreonyl…
lalanyllysyllysylglutamylhistidylglycy…
leucylleucylaspartylasparaginylalanylv…
valylprolylisoleucylthreonylvalylisole…
lseryllysylprolyllysylglycylprolylisol…
tamylisoleucyllysylalanylaspartylseryl…
aspartylvalylprolylglutamylaspartylasp…
soleucylthreonylcysteinyltyrosylseryli…
lthreonylserylglutaminylthreonylaspara…
ysteinylserylserylvalylalanylarginylth…
lprolylasparaginylleucylvalyllysylaspa…
phenylalanylarginylvalylarginylalanylg…
cylvalylserylglutaminylprolylleucylval…
alanyllysylhistidylglutaminylphenylala…
ylprolylglycyllysylprolylvalylisoleucy…
ylaspartylglycylmethionylserylleucylth…
lvalyltyrosylaspartylglycylglycylseryl…
anylhistidylvalylglutamyllysyllysylglu…
ylleucyltryptophylglutaminyllysylvalyl…
ucylserylglycylarginylglutamyltyrosyla…
ylglutamylglycylleucylaspartyltyrosylg…
rosylalanylglutamylasparaginylserylala…
laspartylprolylseryllysylphenylalanylt…
valylaspartylprolylprolylglycylthreony…
rtylvalylthreonylarginylglutamylthreon…
ophylasparaginylprolylprolylleucylargi…
oleucylvalylglycyltyrosylserylisoleucy…
ylasparaginylglutamylarginyltryptophyl…
nylalanylthreonylaspartylvalylserylglu…
onylvalylthreonylglycylleucylserylprol…
mylphenylalanylarginylisoleucylisoleuc…
ylglycylthreonylisoleucylserylprolylpr…
isoleucylisoleucylmethionylthreonylarg…
lprolylprolylisoleucylvalylglutamylphe…
lphenylalanylaspartylglycylleucylisole…
ylserylleucylarginylisoleucyllysylalan…
lprolylvalylprolylarginylvalylthreonyl…
glycylvalylglutamylisoleucylglutamylly…
onylglutamylisoleucylthreonylasparagin…
ylleucylphenylalanylvalylarginylaspart…
idylarginylglycylvalyltyrosylthreonylv…
lanylserylglycylserylalanyllysylalanyl…
ylglutaminylaspartylthreonylprolylglyc…
cylarginylphenylalanylthreonylasparagi…
ysylmethionylthreonylleucyltryptophylt…
asparaginylaspartylglycylcysteinylalan…
rosylisoleucylisoleucylglutamyllysylar…
ucylalanyltryptophylalanylleucylisoleu…
utamylalanylglutaminylseryltyrosylthre…
ucylasparaginylglycylasparaginylglutam…
nylvalylserylalanylvalylasparaginyllys…
nylprolylleucylaspartylserylaspartylpr…
ucylglutaminyltyrosylthreonylvalylprol…
ylprolylglutamylprolylserylasparaginyl…
erylisoleucylthreonylleucylthreonyltry…
erylaspartylglycylglycylserylglutamyli…
isoleucylleucylglutamylarginylarginylg…
yltryptophylvalyllysylvalylisoleucylse…
glutamylthreonylarginylphenylalanyllys…
glutamylglycylasparaginylglutamyltyros…
methionylalanylglutamylasparaginylalan…
ylserylglycylisoleucylserylarginylleuc…
tamylprolylvalylasparaginylprolylproly…
yllysylvalylthreonylaspartylthreonylse…
eucylglutamyltryptophylseryllysylproly…
cylmethionylglutamylisoleucylisoleucyl…
amylmethionylcysteinyllysylthreonylasp…
histidyllysylvalylasparaginylalanylglu…
nylarginyltyrosylthreonylvalylthreonyl…
lglutamylglutamyltyrosyllysylphenylala…
asparaginylglycylalanylglycyllysylglyc…
ylthreonylglycylthreonylisoleucyllysyl…
eonylalanylprolylglutamylleucylasparty…
phenylalanyllysylglutaminylthreonylhis…
lanylserylisoleucylarginylleucylphenyl…
nylglycylarginylprolylthreonylprolylth…
ylprolylaspartylserylasparaginylleucyl…
leucylhistidylthreonylthreonylaspartyl…
lthreonylvalylglutamylasparaginylcyste…
partylalanylglycyllysyltyrosylthreonyl…
nylasparaginylserylglycylseryllysylser…
onylvalyllysylvalylleucylaspartylthreo…
olylisoleucylthreonylphenylalanyllysyl…
erylalanylthreonylleucylmethionyltrypt…
ylaspartylglycylglycylalanylarginyliso…
alylglutamyllysylarginylglutamylalanyl…
lutaminylvalylisoleucylserylglutamylly…
ylisoleucylphenylalanyllysylvalylaspar…
lycylvalylprolyltyrosyltyrosylphenylal…
araginylglutamyltyrosylglycylvalylglyc…
ionylprolylglutamylprolylisoleucylvaly…
olylalanylprolylprolylarginylarginylle…
nylseryllysylserylserylalanylvalylleuc…
aspartylhistidylaspartylglycylglycylse…
rosylleucylleucylglutamylmethionylargi…
ylleucyltryptophylvalylglutamylalanylg…
lleucylthreonylphenylalanylthreonylval…
llysylthreonylglutamyltyrosylglutamylp…
ysylasparaginylaspartylalanylglycyltyr…
mylalanylphenylalanylserylserylvalylis…
glutaminylisoleucylglutamylprolylthreo…
ylisoleucylthreonylasparaginylglutamin…
ysylalanylglycylserylprolylphenylalany…
ylisoleucylserylglycylarginylprolylala…
yllysylleucylglutamylglutamylmethionyl…
spartylarginylvalylserylisoleucylthreo…
inylthreonylthreonylleucylthreonylvaly…
glycylaspartylserylglycylarginyltyrosy…
utamylasparaginylthreonylalanylglycylv…
alylthreonylvalylvalylvalylisoleucylgl…
hreonylglycylprolylisoleucylglutamylva…
ylserylcysteinylvalylleucylseryltrypto…
ylglycylglycylglycylthreonylglutamylis…
oleucylvalylglutamyllysylarginylglutam…
tryptophylglutaminylleucylvalylasparag…
onylglutaminylisoleucyllysylvalylthreo…
ylmethionylglutamyltyrosylserylphenyla…
asparaginylarginylphenylalanylglycylva…
rylalanylprolylisoleucylisoleucylalany…
valylprolylprolylserylalanylprolylthre…
ylhistidylvalylserylalanylasparaginyla…
tryptophylglutamylglutamylprolyltyrosy…
ysylisoleucylisoleucylglycyltyrosyltry…
mylarginylasparaginylthreonylisoleucyl…
sparaginyllysylvalylprolylcysteinylleu…
syllysylvalylthreonylglycylleucylvalyl…
glutaminylphenylalanylarginylthreonylt…
alanylglycylvalylseryllysylalanylseryl…
leucylmethionylalanylglutaminylasparag…
glycylarginylprolylglutamylvalylthreon…
threonylvalylserylleucylisoleucyltrypt…
aspartylglycylglycylseryllysylvalylval…
utamylarginyllysylprolylvalylserylglut…
ltryptophylleucyllysylcysteinylasparag…
rylaspartylasparaginylphenylalanylphen…
leucylserylglutamylglycylaspartylthreo…
ylvalylleucylalanyllysylasparaginylala…
ysylglycylserylglutamylserylthreonylgl…
inylaspartylglutamyltyrosylalanylproly…
artylalanylarginylleucylhistidylglycyl…
larginylalanylglycylserylaspartylleucy…
ylglycylglycyllysylprolylglutamylproly…
hreonyllysylglycylaspartyllysylglutamy…
myllysylvalylserylleucylglutaminyltyro…
threonylalanylvalylisoleucyllysylpheny…
laspartylserylglycyllysyltyrosylthreon…
ylalanylserylglycylthreonyllysylalanyl…
alylleucylaspartylserylprolylglycylpro…
ylvalylserylarginylvalylthreonylglutam…
eucylalanyltryptophylserylleucylprolyl…
cylalanylglutamylisoleucylthreonylhist…
ginylarginylglutamylthreonylserylargin…
soleucylvalylglutamylglycylglutamylcys…
sylvalylvalylthreonylarginylleucylisol…
tamyltyrosylisoleucylphenylalanylargin…
llysyltyrosylglycylprolylglycylvalylpr…
lisoleucylvalylalanylarginylasparaginy…
prolylserylprolylprolylglycylisoleucyl…
reonylglycyllysylglutamylhistidylisole…
ptophylthreonyllysylprolylglutamylsery…
tamylisoleucylserylasparaginyltyrosyll…
myllysylglutamylserylleucylarginyltryp…
yllysylaspartyltyrosylvalylvalyltyrosy…
valylthreonylserylleucylmethionylgluta…
utaminylphenylalanylarginylvalylthreon…
lglycylasparaginylserylglutamylprolyls…
phenylalanylisoleucylserylcysteinylarg…
nylprolylglycylprolylprolylserylalanyl…
onylthreonyllysylhistidylserylisoleucy…
llysylprolylmethionyltyrosylaspartylgl…
valylglycyltyrosylvalylleucylglutamylm…
rtylthreonylaspartylglutaminyltryptoph…
ylasparaginylalanylthreonylisoleucylar…
nylalanylthreonylvalylprolylaspartylle…
ysyltyrosylserylphenylalanylarginylval…
lysylglycylmethionylserylglutamyltyros…
glutamylisoleucylglutamylprolylvalylgl…
ucylprolylaspartylleucylglutamylleucyl…
sylthreonylvalylthreonylisoleucylargin…
nylleucylmethionylvalylserylvalylseryl…
lisoleucylthreonyltryptophylseryllysyl…
ucylalanylserylarginylalanylisoleucyli…
tamylseryltyrosylserylleucylleucylisol…
inylarginyltyrosylaspartylalanylglycyl…
ylalanylglutamylasparaginylglutaminyls…
onylvalylleucylvalyllysylvalyltyrosyla…
steinylprolylserylvalyllysylvalyllysyl…
rylvalylthreonylisoleucylthreonyltrypt…
lisoleucylaspartylglycylglycylalanylpr…
tyrosylisoleucylvalylglutamyllysylargi…
inylalanylphenylalanyllysylthreonylval…
yllysylthreonylleucyltyrosylarginyliso…
lglycylthreonylmethionylhistidyltyrosy…
ylglutamylasparaginylisoleucyltyrosylg…
ysteinylglutamylthreonylserylaspartyla…
alylprolylleucylvalylprolylalanyllysyl…
ylthreonyllysylserylthreonylvalylthreo…
sylprolylleucyltyrosylaspartylglycylgl…
ltyrosylvalylleucylglutamylalanylcyste…
ylarginyltryptophylmethionyllysylvalyl…
nylvalylleucylglutamylhistidylthreonyl…
glutamylglycylglutamylglutaminyltyrosy…
arginylalanylglutaminylasparaginylglut…
olylarginylglutamylthreonylvalylthreon…
laspartylleucylarginylvalylleucylproly…
ylthreonylmethionylprolylglutaminyllys…
lylalanylglycylarginylprolylvalylgluta…
cylalanylglycylarginylprolylprolylprol…
alanylphenylalanylalanylglycylseryllys…
larginylvalylthreonylvalylglutamylthre…
llysylleucylthreonylisoleucylarginylgl…
nylaspartylthreonylglycylglutamyltyros…
asparaginylvalylthreonylglycylthreonyl…
cyllysylvalylisoleucylisoleucylleucyla…
lthreonylglycylprolylisoleucyllysyliso…
rtylalanylthreonylserylisoleucylthreon…
rolylprolylglutamylleucylaspartylglycy…
ltyrosylvalylvalylglutamylglutaminylar…
rolylglycyltryptophylleucylprolylvalyl…
nylserylthreonylphenylalanyllysylpheny…
lglutamylglycylasparaginylglutamyltyro…
nylalanylthreonylasparaginylarginylphe…
tyrosylleucylglutaminylserylglutamylva…
lserylserylisoleucylarginylisoleucylpr…
nylleucylglutaminylisoleucylphenylalan…
glycylmethionylthreonylleucylthreonylt…
laspartylaspartylglycylglycylserylglut…
leucylvalylglutamylarginyllysylglutamy…
ryptophylvalylarginylvalylasparaginyll…
ylthreonylarginyltyrosylarginylserylth…
lycylleucylglutamyltyrosylglutamylhist…
ucylasparaginylalanylarginylglycylsery…
lseryllysylprolylisoleucylvalylalanylm…
ylprolylprolylglycyllysylprolylglutami…
eonylaspartylthreonylthreonylarginylth…
yptophylserylvalylprolylglutamylaspart…
ylthreonylglycyltyrosylleucylisoleucyl…
ylaspartylglutaminylhistidylglutamyltr…
aginylthreonylthreonylprolylthreonylly…
hreonylleucylthreonylhistidylleucylpro…
rosylarginylphenylalanylarginylvalylle…
lglycylglycylprolylglycylglutamylproly…
eonylvalyllysylvalylthreonylglutamylme…
spartyltyrosylglutamylleucylaspartylgl…
mylglycylisoleucylphenylalanylvalylarg…
eucylarginylleucylthreonylisoleucylpro…
henylalanylprolylisoleucylcysteinyllys…
ycylglutaminylaspartylisoleucylserylly…
lanylthreonylserylglutamylthreonylhist…
eucyllysylglutamylalanylaspartylarginy…
yrosylaspartylleucylvalylleucylglutamy…
yllysylalanylvalyltyrosylisoleucyllysy…
rylprolylasparaginylserylprolylglutamy…
spartylaspartylisoleucylglutaminylvaly…
tryptophylarginylprolylprolylalanylasp…
rtylisoleucylleucylglycyltyrosylisoleu…
amylvalylprolyllysylalanylalanyltrypto…
lserylarginylvalylarginylglycylthreony…
ucyllysylglutamylasparaginylvalylgluta…
ylvalylserylalanylglutamylasparaginylg…
lseryllysylprolylleucyllysylserylgluta…
llysylthreonylprolylleucylasparaginylp…
lasparaginylprolylprolylglutamylvalyll…
lserylvalylserylleucylseryltryptophyls…
tylglycylglycylserylarginylvalylthreon…
amylarginyllysylglutamylthreonylserylt…
ylhistidylasparaginyllysylthreonylglut…
onylmethionyltyrosylthreonylvalylthreo…
lanylglutamyltyrosylglutaminylphenylal…
glutaminylasparaginylaspartylvalylglyc…
rolylalanylserylglutamylprolylvalylval…
lalanylaspartyllysylprolylserylglutami…
ylisoleucylleucylserylisoleucylserylly…
glutaminyltryptophylglutamyllysylproly…
cyllysylglutamylisoleucylleucylglycylt…
larginylglutaminylserylglycylaspartyls…
asparaginyllysylglutamylarginylisoleuc…
lalanylthreonylisoleucylglycylglycylle…
tamyltyrosylglutamylphenylalanylarginy…
araginylglutamylthreonylglycylleucylse…
nylalanylmethionylserylisoleucyllysylt…
ylglutamylalanylprolylglycylisoleucyla…
partylvalylthreonylthreonyllysylleucyl…
lleucylserylcysteinylglutaminylisoleuc…
lylaspartylisoleucyllysyltryptophyltyr…
lutamylleucylisoleucylglutaminylseryla…
ylserylaspartylglycylarginylthreonylhi…
thionylthreonylglutamylglutamylglutami…
lyltyrosylthreonylcysteinylisoleucylal…
lglycylglutamylvalylglutamylthreonylse…
aminylalanylthreonylprolylglutaminylph…
ylprolylleucyllysylglutamyllysyltyrosy…
lthreonylleucylarginylleucylhistidylva…
rginylprolylvalylprolylalanylmethionyl…
dylglycylglutaminyllysylleucylleucylgl…
araginylisoleucylthreonylisoleucylglut…
idyltyrosylthreonylhistidylleucylvalyl…
minylarginyllysylthreonylhistidylalany…
inylleucylserylasparaginylvalylphenyla…
nylisoleucylleucylaspartylvalylglutamy…
olylaspartyllysylprolylthreonylglycylp…
lalanylleucylleucyllysylasparaginylser…
yllysylprolylprolylalanylaspartylaspar…
ucylthreonylasparaginyltyrosylvalylval…
nyllysylglutamylglycylalanylglutamyltr…
erylalanylisoleucylserylvalylthreonylt…
ylasparaginylleucylthreonylglutamylasp…
henylalanylarginylvalylserylalanylglut…
ylglycylisoleucylserylaspartylprolylle…
ylisoleucylisoleucyllysylserylprolylph…
alanylprolylglycyllysylprolylthreonyli…
lysylaspartylserylcysteinylvalylvalyla…
nylserylaspartylglycylglycylalanyllysy…
tyrosylleucylglutamyllysylarginylgluta…
ysyltryptophylisoleucylserylvalylthreo…
larginylglutamylthreonylvalylphenylala…
isoleucylglutamylglycylleucylglutamylt…
lyllysylcysteinylglutamylasparaginylle…
yltryptophylserylglutamylisoleucylsery…
lyllysylserylaspartylvalylprolylisoleu…
enylalanyllysylglutamylglutamylleucyla…
alylarginyltyrosylglutaminylserylaspar…
einyllysylvalylthreonylglycylhistidylp…
tryptophyltyrosylarginylglutaminylglyc…
anylaspartylglycylleucyllysyltyrosylar…
nylalanyllysylglycylglycyltyrosylhisti…
ylalanylserylvalylthreonylaspartylaspa…
sylglutaminylvalylarginylalanylthreony…
erylvalylserylglycylthreonylalanylsery…
olylalanyllysylisoleucylhistidylleucyl…
ycylmethionylglycylalanylvalylhistidyl…
lylvalylserylisoleucyllysylisoleucylpr…
lylaspartylprolylvalylisoleucylthreony…
taminylaspartylleucylisoleucylaspartyl…
ltyrosylglutaminylvalylisoleucylvalylt…
onylserylleucylvalylphenylalanylprolyl…
yllysylaspartylalanylglycylphenylalany…
sylasparaginylarginylphenylalanylglycy…
reonylvalylglutamylleucylaspartylvalyl…
olylprolylarginylglycylvalyllysylvalyl…
rtylserylvalylasparaginylleucylthreony…
anylserylaspartylglycylglycylseryllysy…
lisoleucylvalylglutamyllysylcysteinyla…
arginyltryptophylleucylarginylvalylgly…
hreonylarginyltyrosylthreonylvalylisol…
lycyllysylthreonylseryltyrosylglutamin…
alanylglutamylasparaginyllysylphenylal…
ylglutamylprolylserylglutamylprolylthr…
aspartyllysylthreonylarginylalanylmeth…
amylglutamylvalylaspartylglutamylthreo…
ylthreonyllysylalanylserylhistidylsery…
rosylglutamyllysyltyrosylmethionylisol…
ycylarginylglycylglutamylphenylalanylg…
ysteinylvalylglutamylthreonylserylsery…
alanyllysylphenylalanylvalyllysylvalyl…
ylvalylleucylvalyllysyllysylglutamylis…
nylisoleucylalanylarginylhistidylargin…
lleucylhistidylglutamylserylphenylalan…
tamylleucylvalylmethionylisoleucylphen…
ylserylglycylleucylaspartylisoleucylph…
sparaginylthreonylserylalanylphenylala…
larginylglutamylisoleucylvalylseryltyr…
teinylglutamylalanylleucylglutaminylph…
ylasparaginylisoleucylglycylhistidylph…
rolylglutamylasparaginylisoleucylisole…
larginylserylserylthreonylisoleucyllys…
lanylglycylglutaminylalanylarginylglut…
ylasparaginylphenylalanylarginylleucyl…
lylglutamyltyrosyltyrosylalanylprolylg…
dylaspartylvalylvalylserylthreonylalan…
ylserylleucylglycylthreonylleucylvalyl…
isoleucylasparaginylprolylphenylalanyl…
inylglutaminylglutaminylisoleucylisole…
hionylasparaginylalanylglutamyltyrosyl…
lglutamylalanylphenylalanyllysylglutam…
anylmethionylaspartylphenylalanylvalyl…
ylglutamylarginyllysylserylarginylmeth…
nylleucylglutaminylhistidylprolyltrypt…
eucylglutamylarginylvalylserylthreonyl…
eucyllysylhistidylarginylarginyltyrosy…
ucyllysyllysylaspartylleucylasparaginy…
ylarginylisoleucylserylcysteinylglycyl…
utaminyllysylglycylvalylserylvalylalan…
oleucylglutamylisoleucylglycylprolylva…
thionylhistidylalanylvalylglycylglutam…
lysyltyrosylvalylcysteinyllysylisoleuc…
lglutaminylserylthreonylglutaminylvaly…
nylglycylvalylarginylglutaminylleucylg…
ltyrosylglutamylisoleucylthreonyltyros…
isoleucylleucyltyrosylvalyllysylaspart…
tylaspartylglycylthreonyltyrosylarginy…
laspartyltyrosylglycylglutamylaspartyl…
ylphenylalanylvalyllysylglycylvalylarg…
osyltyrosylcysteinylarginylarginylthre…
ylarginylarginylthreonylaspartylthreon…
mylarginylprolylprolylglutamylphenylal…
ylasparaginyllysylthreonylalanyltyrosy…
larginylphenylalanylglycylvalylthreony…
ylglutamylprolylhistidylvalylthreonylt…
taminyllysylisoleucyllysylprolylglycyl…
yltyrosylthreonylphenylalanylglutamyls…
lglutaminylleucylthreonylisoleucylaspa…
partylaspartylaspartylalanylglutamylty…
lasparaginyllysyltyrosylglycylglutamyl…
sylleucylthreonylvalylthreonylleucylhi…
artylserylthreonylleucylarginylprolylm…
cylleucylalanylasparaginylalanylglutam…
glutaminylserylvalylcysteinylphenylala…
ylglycylisoleucylprolylprolylprolylthr…
ysylaspartylglycylglutaminylprolylleuc…
lisoleucylglutamylisoleucylisoleucylhi…
yrosyltyrosylalanylleucylhistidylisole…
olylglutamylaspartylthreonylglycyltyro…
lthreonylasparaginylthreonylalanylglyc…
inylalanylhistidylleucylglutaminylvaly…
llysyllysylglutaminylglutamylphenylala…
istidylglutamylarginylhistidylvalylglu…
rtyllysylthreonylleucylarginylmethiony…
glycylthreonylglutamylserylvalylprolyl…
lysylglutamylalanylleucylarginylglutam…
ylprolylalanylvalylserylthreonyllysylt…
ylalanylarginylleucylglutamylisoleucyl…
lutamylarginyllysylleucylarginylmethio…
glutamylprolylarginyllysyltyrosyllysyl…
glutamylglutamylaspartylglutaminylargi…
anylvalylprolylmethionylserylaspartylm…
lysylisoleucylarginylaspartylglutaminy…
yllysylleucylaspartylarginylvalylvalyl…
ginylisoleucylarginylleucylserylarginy…
alanyltyrosylvalylmethionylprolylleucy…
rtylglutaminyltyrosylarginylprolyllysy…
sylleucylserylglutaminylaspartylaspart…
ylprolylalanylarginylarginylarginylthr…
ylaspartylphenylalanyltyrosyltyrosylar…
ylleucylglycylaspartylisoleucylserylas…
eucylprolylisoleucylaspartylaspartylty…
nylthreonylglutamylglutamylglutamylarg…
amylglutamylleucylglutamylleucylglycyl…
rolylserylarginylserylprolylprolylhist…
serylleucylarginyltyrosylserylserylpro…
ylvalylglutamylglutamylthreonylarginyl…
tyrosylserylthreonyltyrosylhistidyliso…
amylalanylserylthreonylseryltyrosylala…
inylhistidylalanylglutaminylalanylalan…
ylglutaminylarginylglutaminylarginylis…
ylglutamylaspartylglutamylglutamylleuc…
hreonylthreonylglutaminylhistidylleucy…
amylleucylaspartylphenylalanylmethiony…
ylarginyllysyllysylserylarginylarginyl…
nylglutamylisoleucylthreonylglutamylis…
sylglutamylisoleucylseryllysylhistidyl…
lserylserylserylalanylserylarginylleuc…
lserylleucylserylprolylthreonyltyrosyl…
inylprolylvalylserylglutamylleucylisol…
minylprolylalanylglutamylglutamyltyros…
lutamylarginylarginylserylprolylthreon…
nylprolylarginylserylprolylserylprolyl…
leucylserylarginylphenylalanylglutamyl…
ylaspartylisoleucylphenylalanylserylar…
ysylalanylalanylleucyllysylthreonylglu…
ginyllysyltyrosylglutamylvalylleucylse…
alanylthreonylleucylaspartylhistidylal…
eucylarginylmethionylarginylserylhisti…
lglutaminylasparaginylthreonylarginylp…
ylvalylglutaminylseryllysylprolylthreo…
yltyrosylhistidylasparaginylglycylvaly…
rylseryllysylisoleucylhistidyltyrosylt…
ylvalylleucylthreonylleucylglutamyliso…
ylthreonylaspartylaspartylserylglycylt…
teinylthreonylasparaginyltyrosyllysylg…
osylalanylthreonylleucylaspartylvalylt…
hreonylthreonyltyrosylalanylserylgluta…
glutamylvalylprolylarginylserylvalylph…
nylarginylthreonylglutamylalanyltyrosy…
lysyllysylthreonylserylglutamylmethion…
larginylglutamylvalyllysylserylglutami…
larginylglutamylserylleucylserylserylt…
rylalanylglutamylmethionyllysylserylal…
ylserylleucylglutamylglutamyllysylsery…
cyllysylthreonylthreonylleucylalanylal…
ysylprolylarginylserylmethionylthreony…
serylalanylarginylphenylalanylserylcys…
lglutamylprolylvalylprolylthreonylvaly…
ylglycylglutaminylvalylleucylserylthre…
minylvalylthreonylthreonylthreonyllysy…
nylglutamylisoleucylserylserylvalylglu…
lycylasparaginyltyrosylserylvalylvalyl…
ylglycyllysylglutaminylglutamylalanylg…
reonylisoleucylglutaminyllysylalanylar…
ylvalylthreonylserylprolylprolylarginy…
larginylvalyllysylserylprolylglutamyla…
nylvalyllysylserylprolylglutamylprolyl…
serylprolylthreonylglutamylthreonyllys…
yllysylvalylglutaminylhistidylleucylpr…
ylisoleucylthreonylglutaminylphenylala…
eryllysylglutamylisoleucylalanyllysyll…
tamylserylserylvalylleucylarginylalany…
yltyrosyllysylaspartylglycyllysyllysyl…
lhistidylphenylalanylglutaminylphenyla…
rtylglycylthreonyltyrosylglutamylleucy…
ylleucylthreonylglutamylserylaspartylg…
cysteinylglutamylisoleucylserylglycylg…
ylthreonylasparaginylleucylglutaminylp…
lalanylphenylalanyllysylserylisoleucyl…
lisoleucylserylglutamylthreonyllysylly…
onylthreonylglutamylserylthreonylvalyl…
lprolyllysylalanylprolylglutamylprolyl…
isoleucylvalylthreonylglycylleucylglut…
serylserylaspartylserylvalylalanyllysy…
threonylglycylglutamylprolylarginylpro…
lthreonyllysylaspartylglycyllysylalany…
lycyllysyltyrosyllysylleucylserylgluta…
lanylphenylalanylleucylglutamylisoleuc…
onylserylaspartylserylglycylleucyltyro…
sylasparaginylserylalanylglycylserylva…
cylthreonylisoleucyllysylalanylisoleuc…
ylglutaminyllysylvalylserylthreonylglu…
oleucylthreonylprolylglutaminyllysylly…
ylglutamylisoleucylserylglutaminyllysy…
utamylisoleucyllysylmethionylserylglut…
myllysylleucylalanylleucyllysylglutamy…
lisoleucylserylglutamylglutamylvalylly…
rylleucylglutamyllysylserylisoleucylva…
lthreonyllysylthreonylserylglutaminyla…
nylthreonylhistidylalanylglutamylisole…
eonylglutaminylmethionylserylisoleucyl…
arginylleucylvalylleucyllysylalanylasp…
threonylaspartylvalyllysyltryptophylva…
amylleucylthreonylasparaginylserylglut…
ycylvalylserylglycylserylaspartylgluta…
llysylglutaminylalanylserylhistidylarg…
leucylthreonylcysteinylisoleucylseryll…
eucylvalyllysylcysteinylglutaminyltyro…
llysylglutamylleucylserylaspartylalany…
erylglutaminylprolylarginylserylglutam…
glutamylglycylglutaminylasparaginylval…
ylglutamylisoleucylserylglycylglutamyl…
lutamyltryptophylphenylalanyllysylaspa…
ucylserylisoleucylserylserylasparaginy…
ylarginylasparaginylvalyltyrosylseryll…
ginylalanylserylvalylserylaspartylsery…
llysylalanyllysylasparaginylphenylalan…
erylalanylthreonylalanylserylleucylmet…
lutamylglutamylprolylserylarginylgluta…
erylglycylaspartylthreonylserylleucylg…
ylserylglutaminylserylvalylglutaminylm…
inylglutamylalanylserylphenylalanylser…
erylalanylserylserylmethionylthreonylg…
anylserylmethionylserylalanylglutaminy…
lutaminylglutamylserylphenylalanylvaly…
rylphenylalanylmethionylglycylisoleucy…
lutaminylleucylglutamylserylserylthreo…
anylglycylisoleucylarginylglycylisoleu…
ylalanylleucylprolylserylaspartylisole…
lycyllysylvalylleucylthreonylvalylalan…
ylglycylglutamylprolylthreonylprolylgl…
ysteinylglycylglycylarginyllysylisoleu…
lutaminylglycylarginylphenylalanylhist…
eonylaspartylaspartylleucylthreonylthr…
nylaspartylvalylglutaminyllysylglutami…
lthreonylleucylserylleucylglycylaspara…
laspartylserylalanylthreonylvalylaspar…
inylserylisoleucine

[size=5]Source(s):[/size]
http://en.wikipedia.org/wiki/Titin
  • 62 people rated this as good

Asker's Rating:Asker's Comment:i am supprised it was on that page because, i also have went on that page, but didn't find it…



[size=5]Other Answers (3)[/size]

  • Titin, also known as connectin, (UniProt name: Q10466_HUMAN; accession number: Q10466) is a protein that is important in the contraction of striated muscle tissues. Titin connects the Z line to the M line in the sarcomere. The protein limits the range of motion of the sarcomere in tension, thus contributing to the passive stiffness of muscle. Variations in the sequence of titin between different types of muscle (e.g. cardiac or skeletal) has been correlated with differences in the mechanical properties of the muscles. Titin is the largest known protein, consisting of 26,926 amino acids. The molecular weight of the mature protein is approximately 2,993,451.39 Da, and it has a theoretical pI of 6.35 [1]. The protein's chemical formula is C132983H211861N36149O40883S693. It has a theoretical instability index (II) of 39.69, indicating that it would be stable in a test tube. The protein's in vivo half-life, the time it takes for half of the amount of protein in a cell to disappear after its synthesis in the cell, is predicted to be approximately 30 hours (in mammalian reticulocytes). As the largest known protein, titin has the longest full chemical name. The full chemical name, containing 189,819 letters, is sometimes claimed to be the longest word in the English language: Methionylthreonylthreonylglutaminylala… ylglutaminylprolylleucylglutaminylsery… lserylthreonylalanylthreonylphenylalan… rylglycylphenylalanylprolylvalylprolyl… lanylarginylaspartylglycylglutaminylva… nylleucylprolylglycylvalylglutaminylis… ylglycylarginylalanyllysylleucylthreon… llysylalanylasparaginylserylglycylargi… eonylasparaginylglycylserylglycylgluta… nylglutamylleucylleucylvalyllysylalany… asparaginylphenylalanylvalylglutaminyl… ylthreonylvalylarginylglutaminylglycyl… utaminylvalylarginylvalylthreonylglycy… lylvalyllysylphenylalanyltyrosylarginy… cylglutaminylserylserylleucylaspartylp… glutaminylglutamylglycylaspartylleucyl… anylglutamylalanyltyrosylprolylglutamy… serylvalylasparaginylalanylthreonylasp… ylthreonylserylthreonylalanylglutamyll… tamylglutamylglutamylvalylprolylalanyl… eucylvalylserylthreonylalanylglutaminy… glutaminylthreonylarginylisoleucylglut… ylhistidylphenylalanylaspartylalanylar… lylglutamylmethionylvalylisoleucylaspa… nylglutaminylleucylprolylhistidyllysyl… lprolylprolyllysylprolyllysylserylargi… erylisoleucylalanylalanyllysylalanylgl… ylglutaminylserylprolylserylprolylisol… lprolylvalylarginylhistidylvalylarginy… lylvalylarginylserylvalylserylprolylal… onylserylprolylisoleucylarginylserylva… thionylarginyllysylthreonylglutaminyla… ylglycylprolylglutamylvalylprolylproly… tamylglycyltyrosylvalylalanylserylsery… ylarginylglutamylthreonylthreonylleucy… minylisoleucylarginylthreonylglutamylg… cylarginyltyrosylglycylvalylglutaminyl… eucylserylglycylalanylalanylglycylalan… serylalanylseryltyrosylalanylalanylglu… lalanyllysylglutamylvalyllysylglutamin… lanylalanylvalylalanylthreonylvalylval… lalanylarginylvalylarginylglutamylprol… tamylglutaminylthreonylalanylglutaminy… eonylalanylvalylhistidylisoleucylgluta… glutaminylvalylarginyllysylglutamylala… threonyllysylvalylvalylvalylalanylalan… lutaminylglutamylleucyllysylserylargin… leucylthreonylthreonyllysylglutaminylg… alylthreonylhistidylglutamylglutaminyl… ylglutamyllysylthreonylphenylalanylval… ylalanylalanyllysylalanyllysylglutamyl… oleucylserylglutamylglutamylisoleucylt… taminylvalylthreonylglutaminylglutamyl… ylthreonylarginyllysylthreonylvalylval… nylthreonylprolyllysylvalyllysylglutam… larginylglycylarginylglutamylglycyliso… lutamylglutaminylvalylglutaminylisoleu… ethionylarginyllysylglutamylalanylglut… hreonylisoleucylalanylvalylalanylthreo… utaminylglutamylthreonylisoleucylleucy… onylmethionylalanylthreonylarginylglut… utaminylvalylthreonylhistidylglycyllys… lalanylglutamylalanylvalylalanylthreon… ylglutaminylalanylarginylvalylarginylg… lycylhistidylleucylglutamylglutamylser… threonylthreonylleucylglutamyltyrosylg… leucylserylalanylalanyllysylvalylalany… nylprolylalanylserylglutamylprolylhist… llysylprolylarginylvalylisoleucylgluta… nylhistidylisoleucyllysylthreonylthreo… hionylhistidylisoleucylserylserylgluta… eonylaspartylleucylthreonylthreonylglu… laspartyllysylarginylprolylarginylthre… alanylthreonylvalylseryllysylisoleucyl… ylhistidylglycyltyrosylglutamylalanyls… lisoleucylalanylthreonylleucylglutamin… eonylserylserylalanylglutaminyllysylis… alanylprolylthreonylvalyllysylprolylse… nylalanylglutamylprolylthreonylprolyll… olylphenylalanylalanylaspartylthreonyl… erylglutamylalanylglycylvalylglutamylv… lylserylisoleucylthreonylglycylthreony… ylarginylphenylalanylglutamylvalylleuc… yllysylvalylthreonylglutamylthreonylal… alylglutamylisoleucylprolylvalylthreon… rylglycylleucyllysylasparaginylvalylth… lutamylserylvalylthreonylleucylglutamy… cyltyrosylprolylserylprolylthreonylval… lutamylaspartyltyrosylglutaminylisoleu… tylphenylalanylglutaminylisoleucylthre… ylisoleucylalanylarginylleucylmethiony… ylalanylalanylglutamylaspartylserylgly… inylserylalanylvalylasparaginylglutamy… onylserylcysteinyltyrosylleucylalanylv… tamylphenylalanylglutamyllysylglutamyl… glutamyllysylphenylalanylthreonylthreo… ylalanylvalylglutamylserylarginylaspar… tylthreonylserylleucylthreonylglutamyl… lglycylglutamylprolylalanylalanylproly… yllysylprolylvalylvalylglutaminyllysyl… lvalylvalylphenylalanylglycylcysteinyl… nylprolyllysylprolylhistidylvalyltyros… lylprolylleucylthreonylthreonylglycylt… tyrosylasparaginyllysylglutaminylthreo… ylvalylisoleucylserylmethionylthreonyl… lanylglycylglutamyltyrosylthreonylisol… sylhistidylglycylglutamylthreonylseryl… lutamylglutamylalanylaspartyltyrosylgl… ylglutaminylglutaminylglutamylmethiony… taminylvalylthreonylalanylphenylalanyl… ylvalylglycylglutamylthreonylalanylpro… rylglutamyltyrosylglutamyllysylglutamy… inylalanylleucylisoleucylarginyllysyll… eonylvalylvalylvalylarginylthreonyltyr… glutamylphenylalanylhistidylisoleucyls… ylarginylleucylisoleucyllysylglutamyli… ucylisoleucyllysylthreonylthreonylleuc… mylglutamylaspartylglycylglutamylgluta… lisoleucylserylglutamylserylglutamylal… lanylaspartylleucylarginylisoleucyllys… lleucylglutamylglycylmethionylglycylva… einyllysylmethionylserylglycyltyrosylp… yltryptophyltyrosyllysylaspartylglycyl… lycylglutamylarginyltyrosylglutaminylm… lutaminylaspartylglycylarginylalanylse… lvalylleucylprolylglutamylaspartylglut… lanylphenylalanylalanylserylasparaginy… nylisoleucylcysteinylserylglycyllysyll… ylalanylprolylleucylglycylalanylprolyl… nylleucylglutamylprolylvalylserylargin… rolylarginylserylvalylserylarginylsery… ylprolylalanylarginylmethionylserylpro… lalanylarginylmethionylserylprolylalan… arginylarginylleucylglutamylglutamylth… ylleucylglutamylarginylleucyltyrosylly… yllysylprolylvalylserylphenylalanyllys… ylasparaginylcysteinylarginylphenylala… cylarginylprolylmethionylprolylglutamy… ylalanylhistidylaspartylglycylglutamin… ylaspartyltyrosylthreonylhistidyllysyl… artylglycylthreonylglutaminylserylleuc… ylthreonylprolylserylaspartylserylglyc… lylalanylglutaminylasparaginylarginyla… ylserylvalylisoleucylleucylthreonylval… ylglutaminylvalyllysylprolylmethionylp… lysylasparaginylvalylasparaginylisoleu… eucylglutamylmethionyllysylvalylarginy… lylasparaginylprolylaspartylisoleucylv… lserylaspartylisoleucylisoleucylvalylp… lisoleucylarginylisoleucylglutamylglyc… alanylleucyllysylisoleucylaspartylsery… ylserylalanyltryptophyltyrosylthreonyl… ginyllysylalanylglycylarginylaspartylt… lvalylasparaginylvalylglutamylvalylglu… ylglutamylprolylglutamylarginyllysylle… glycylthreonyltyrosylarginylalanyllysy… lglutamylleucylglutamylprolylleucylhis… aminylglutamylglutaminyltryptophylglut… osylaspartyllysylglutamyllysylglutamin… phenylalanyllysyllysyllysylleucylthreo… inylphenylalanylglycylprolylalanylhist… ginylleucylthreonylprolylisoleucylsery… ylvalylglutamyltryptophylleucylhistidy… tamylalanylalanylasparaginylarginylleu… inylglutamylphenylalanylglycyltyrosylc… lycylvalylalanyltyrosylserylarginylasp… hreonylcysteinylarginylalanylthreonyla… laspartylhistidylthreonylserylalanylth… rtylglutamyllysylserylleucylvalylgluta… lylglutamylglycylarginyllysylglycylleu… ylglutamylleucylglutamylarginylmethion… lleucylthreonylglycylvalylthreonylthre… lysylglutaminyllysylprolylaspartylisol… ylprolylvalylarginylvalylleucylglutamy… lphenylalanylarginylcysteinylarginylva… minylprolyllysylvalylasparaginyltrypto… lutaminylleucylisoleucylarginyllysylse… alylarginyltyrosylaspartylglycylisoleu… leucylvalylaspartylcysteinyllysylseryl… ylvalyllysylvalylthreonylalanylglutamy… ylisoleucylglutamylhistidyllysylvalyll… ylglutaminylarginylglutamylaspartylphe… inylarginylalanylprolylglutamylprolyla… tidylvalylhistidylglutamylprolylglycyl… utamylvalylglutaminyllysylvalylasparty… threonylglutamylthreonyllysylglutamylv… nylglutamylarginylisoleucylthreonylhis… ylglutamylserylglutamylglutamylleucyla… ginylarginylthreonylglutamylglutamylgl… leucylthreonylalanylvalylglutamylleucy… lglutamylseryltyrosylglutamylglutamyll… laspartylglutamylleucylleucylhistidylt… lthreonylglutamylglutamylglutamyllysyl… amylglycyllysylisoleucylthreonylisoleu… rolylaspartyllysylisoleucylglutamylleu… lalanylprolyllysylisoleucylphenylalany… serylglutaminylthreonylvalylglycylglut… idylphenylalanylarginylvalylarginylval… lylglutamylcysteinylglutamyltryptophyl… ysylisoleucylglutamylarginylserylaspar… ltyrosyltryptophylprolylglutamylaspart… leucylvalylisoleucylarginylaspartylval… ylalanylserylisoleucylmethionylvalylly… cylalanylglycylglutamylthreonylserylse… leucylvalylglutaminylalanyllysylglutam… anylthreonylglutaminylglutamylleucylgl… ylglutamyllysylaspartylthreonylmethion… lcysteinylglutamylthreonylserylglutamy… ysyltryptophyltyrosyllysylaspartylglyc… tamylglycylaspartyllysyltyrosylarginyl… yllysylvalylhistidylphenylalanylleucyl… ylaspartylthreonylserylaspartylalanylg… lvalylleucylvalylglutamylaspartylgluta… eonylalanyllysylleucylisoleucylvalylgl… lphenylalanylvalyllysylglutamylleucylg… alylprolylglutamylseryltyrosylserylgly… soleucylvalylserylprolylglutamylaspara… yptophyltyrosylhistidylasparaginylaspa… paraginylglycyllysyltyrosylthreonyliso… ycylarginylglutaminylasparaginylleucyl… onyllysylglutamylaspartylglutaminylgly… valylisoleucylaspartylglycyllysyllysyl… llysylmethionyllysylprolylarginylproly… aminylglycylleucylserylaspartylglutami… laspartylisoleucylvalylglutaminylleucy… glutamylserylvalylglutamylglycylvalylt… ylglutaminylglutamylvalylglutaminylpro… lisoleucylvalylisoleucylaspartyllysylg… ylleucylisoleucylglutamylaspartylmethi… anylglycylasparaginyltyrosylserylpheny… lleucylglycylleucylserylthreonylserylg… erylvalylaspartylvalylisoleucylthreony… raginylvalylisoleucylglutamylglycylthr… cysteinyllysylvalylserylvalylprolylasp… yptophyltyrosylleucylasparaginylaspart… rolylaspartylaspartylarginylvalylgluta… lthreonyllysylglutaminylarginylleucylv… onylhistidylalanylserylaspartylglutamy… eucylvalylglycylarginylvalylglutamylth… ylleucylserylvalylglutamyllysylisoleuc… cylleucylarginylaspartylleucylthreonyl… utaminylasparaginylvalylvalylphenylala… histidylserylglycylisoleucylaspartylva… lalanyllysylaspartyllysylglutamylisole… yllysylisoleucylglutamylalanylhistidyl… cylthreonylvalylleucylasparaginylmethi… lutamylglycyllysyltyrosylthreonylpheny… sparaginylmethionylthreonylserylglycyl… lglycylalanylisoleucylseryllysylprolyl… eonylvalylalanylglutamylserylglutaminy… tamylcysteinylglutamylvalylalanylaspar… lglutamyltryptophylleucylarginylaspart… ucylthreonylasparaginylasparaginylisol… tylglycylhistidyllysylarginylarginylle… hreonyllysylleucylaspartylaspartylisol… yrosyllysylvalylalanylthreonylseryllys… ylvalylglutamylalanylvalyllysylisoleuc… raginylleucylthreonylvalylthreonylglut… lvalylphenylalanylthreonylvalylglutamy… ginylvalyllysylglycylvalylglutaminyltr… ycylvalylvalylleucylglutamylserylaspar… leucylserylvalyllysylglycylthreonyliso… eucyllysylasparaginylcysteinylalanylis… lyltyrosylglycylphenylalanylarginylleu… erylalanylarginylleucylhistidylvalylgl… oleucyllysyllysylprolyllysylaspartylva… raginylalanylthreonylvalylalanylphenyl… istidylaspartylthreonylvalylprolylvaly… llysylserylvalylglutamylisoleucyllysyl… inylleucylvalylserylglutamylarginyllys… leucylglutaminylasparaginylisoleucylse… lutamyltyrosylthreonylalanylvalylvalyl… inyllysylalanyllysylleucylphenylalanyl… isoleucylthreonyllysylthreonylmethiony… alylprolylglutamylthreonyllysylthreony… teinylglutamylvalylserylhistidylphenyl… thionyltryptophylleucyllysylasparaginy… ylmethionylserylglutamyllysylphenylala… ylglycyllysylleucylhistidylglutaminyll… araginylthreonylserylthreonylglutamyla… reonylphenylalanylvalylcysteinylglycyl… erylalanylthreonylleucylthreonylvalylt… eucylthreonylserylmethionylleucyllysyl… lutamylglutamyllysylaspartylthreonylis… valylthreonylvalylasparaginyltyrosylgl… syltryptophylleucyllysylasparaginylgly… threonylaspartyllysylcysteinylglutamin… lleucylthreonylhistidylserylleucylaspa… alylhistidylphenylalanylglycylaspartyl… phenylalanylvalylalanylglycyllysylalan… ylleucyltyrosylvalylglutamylalanylargi… lanylarginyllysylhistidylisoleucyllysy… lutamyllysyllysylarginylalanylmethiony… mylvalylserylglutamylprolylaspartyliso… phylmethionyllysylaspartylaspartylglut… ucylthreonylaspartylarginylisoleucylly… lysyltyrosylvalylhistidylarginylleucyl… rginylmethionylserylaspartylalanylglyc… nylglycylglycylasparaginylvalylserylth… valylglutamylglycylarginylaspartylvaly… cyllysyllysylglutamylvalylglutaminylva… arginylalanylvalylvalylglutamylphenyla… ylaspartylaspartylvalylaspartylalanylh… ylglycylisoleucylglutamylisoleucylaspa… lutaminylglutamylarginylhistidyllysylt… nylisoleucylhistidylarginylmethionylph… eonylarginylglutaminylserylaspartylala… nylalanylvalylalanylglycylarginylaspar… lleucyltyrosylvalylasparaginylalanylpr… alylleucylglutaminylglutamylleucylglut… minylserylglycyllysylprolylalanylargin… nylisoleucylserylglycylarginylprolylgl… yptophyltyrosyllysylglutamylglutamylgl… ycylphenylalanyllysylcysteinyllysylphe… ylglutaminylglutamyltyrosylthreonylleu… nylphenylalanylprolylglutamylaspartyla… einylglutamylalanyllysylasparaginylasp… ylthreonylserylalanylserylleucylserylv… lvalylserylprolylaspartylglutaminylglu… lylprolylalanylisoleucylisoleucylthreo… reonylvalylthreonylserylglutamylglycyl… alanylglutaminylcysteinylarginylvalyls… ylvalylseryltryptophyltyrosylseryllysy… olylserylarginylphenylalanylphenylalan… lphenylalanylglutamylaspartylthreonylt… ucylalanylglutamylalanyltyrosylprolylg… yltyrosylthreonylphenylalanylvalylalan… glycylglutaminylvalylserylserylthreony… glutamylalanylprolylglutamylserylisole… oleucylglutamylglutaminylglutamylisole… nyllysylglutamylphenylalanylserylseryl… lutamylglutamylglutamylglycylleucylhis… minylleucylseryllysylisoleucylasparagi… ucylleucylserylglutamylserylprolylvaly… anylaspartylserylglutamyllysylglutamyl… phenylalanylisoleucyllysylglutamylvaly… eucylserylmethionylglycylaspartylvalyl… nylvalylisoleucylglycylisoleucylprolyl… tryptophylphenylalanylphenylalanylaspa… nylprolylserylalanylaspartyltyrosyllys… rtylglycylaspartylaspartylhistidylsery… ylalanylthreonyllysylleucylglutamylasp… hreonylcysteinylmethionylalanylserylas… threonylisoleucylcysteinylserylalanylt… ylseryllysylglycylglutamylglycylhistid… onylglutamylserylalanylvalylalanyllysy… ylglycylprolylcysteinylprolylprolylhis… lleucyllysylprolylisoleucylarginylcyst… olylalanylisoleucylphenylalanylglutamy… tamylprolylalanylprolylthreonylvalylth… utamylasparaginyllysylglutaminylleucyl… yrosylthreonylisoleucylisoleucylhistid… lserylglycylthreonylphenylalanylisoleu… utaminylarginylglutamylaspartylserylgl… lysylalanylglutamylasparaginylmethiony… ysteinylalanylalanylglutamylleucylleuc… threonylaspartylmethionylthreonylaspar… yllysylserylthreonylprolylglutamylalan… lprolylglutaminylthreonylprolylleucyll… alanylleucylaspartylserylglutamylgluta… lphenylalanylvalyllysylaspartylthreony… ucylisoleucylthreonylglutamylglutamyla… lseryltyrosylglutamylhistidylisoleucyl… lleucylserylserylglutaminylleucylproly… ylleucylglutaminylserylisoleucylleucyl… ylthreonylprolylglutamylserylthreonyla… teinylisoleucylasparaginylglycylseryli… nylprolylleucyllysylglutamylprolylsery… eucylglutaminylisoleucylvalylglutaminy… alanylseryllysylglutamylglycylisoleucy… mylprolylglutamylthreonylglutaminylala… glutamyllysylisoleucylphenylalanylprol… lglutamylglutaminylisoleucylasparaginy… olylleucyllysylthreonylleucylleucylala… raginyltyrosylprolylglutaminylserylser… ionylhistidylseryltyrosylleucylthreony… lylleucylserylleucyllysylglutamyllysyl… sparaginylarginylglutamylglutaminylarg… sylglutaminylglutamylalanylglutaminyls… lglutaminylserylleucylalanylglutamylgl… lglutaminylserylprolylaspartylvalylmet… asparaginyltyrosylglutamylprolylleucyl… ylcysteinylthreonylglutamylglycylglycy… mylserylalanylasparaginylprolylleucylg… minylaspartylserylalanylvalylarginylis… erylleucylarginylphenylalanylprolylleu… lglutaminylvalylleucylleucyllysylgluta… araginylvalylvalylmethionylprolylproly… ylglutamylseryllysylarginylglutamylpro… lylglutaminylglutamylvalylglutaminylgl… llysylglutamylserylleucylleucylserylgl… glutaminylarginylleucylasparaginylleuc… cysteinylarginylalanylleucylglutaminyl… lglutaminylprolylglycylleucylphenylala… inylasparaginylisoleucylglutamyllysylv… lasparaginylisoleucylthreonylglutaminy… ucylmethionylcysteinylmethionyltyrosyl… serylvalylthreonylglutamylglutamylvaly… lglutamylaspartylvalylaspartylprolylgl… eucyllysylmethionylglutamylleucylargin… ylisoleucylisoleucyltyrosylglutamylglu… ylthreonylalanylglutamylglycylprolylar… lycylalanyllysylthreonylserylleucylglu… artylserylphenylalanylserylglycylseryl… soleucylthreonylglutamylprolylglutamyl… lisoleucylserylthreonylglutamylglutamy… aginylvalylglutaminylserylarginylvalyl… eonylprolylvalylthreonyllysylglycylval… spartylglutamyllysylglutaminylaspartyl… glutamylglutamyllysylglutamylglutamyls… reonylglutamylglutamylvalylalanylthreo… tamylalanylglutamylglycylglycylleucyli… prolylmethionylisoleucylhistidylthreon… valylserylglutamylglutamylglycylaspart… nylthreonylserylisoleucylthreonylaspar… aginyltryptophyltyrosylphenylalanylglu… lylserylaspartylglutamyllysylphenylala… partylglutaminylasparaginylthreonyltyr… artyllysylvalylasparaginylthreonylglut… lglutamyltyrosylvalylcysteinylglutamyl… lglycyllysylthreonylalanylthreonylsery… llysylarginylalanylalanylprolylvalylis… utamylprolylleucylglutamylvalylalanyll… lphenylalanylthreonylcysteinylglutamyl… lasparaginylvalylarginylphenylalanylgl… alanylglycylarginylglutamylisoleucylty… einylserylisoleucylarginylserylserylly… glutamylisoleucylleucylarginylthreonyl… ylglycylglutamyltyrosylthreonylcystein… yltyrosylglycylserylvalylserylcysteiny… ylvalylthreonylvalylprolylglycylglycyl… leucylleucylprolylglutamylarginyllysyl… utamylvalylvalylleucyllysylserylvalyll… mylglutamylglutamylglutamylprolyllysyl… glutamyllysylvalyllysyllysylprolylalan… olylprolyllysylprolylvalylglutamylglut… lvalylthreonyllysylarginylglutamylargi… ylthreonyllysylvalylprolylglutamylisol… ylleucylprolylalanylprolylglutamylprol… nylglutamylvalyllysylthreonylisoleucyl… lprolylglutamylprolylthreonylprolyliso… ylvalylprolylvalylvalylglycyllysyllysy… lyllysylglutamylglutamylalanylalanylly… lysylglycylvalylprolyllysyllysylthreon… lalanylglutamylarginylarginyllysylleuc… cylglutamyllysylprolylprolylaspartylgl… nyltyrosylglutaminylleucyllysylalanylv… lyllysylglutamylisoleucyllysylaspartyl… tamylserylglutamylphenylalanylvalylgly… lanylglutamylcysteinylleucylvalylseryl… hreonylthreonyltryptophylmethionyllysy… eucylarginylglutamylserylprolyllysylhi… lanylaspartylglycyllysylaspartylarginy… cylaspartylvalylglutaminylleucylseryla… hreonylcysteinylvalylleucylarginylleuc… ylthreonylserylthreonylalanyllysylleuc… rolylvalylarginylphenylalanylvalyllysy… amylvalylthreonylvalylvalyllysylglycyl… serylcysteinylglutamylleucylasparaginy… alyltryptophylarginyllysylaspartylglyc… ysylprolylglycylarginylisoleucylvalylp… ylmethionylarginylalanylleucylthreonyl… spartylaspartylthreonylaspartylalanylg… reonylvalylglutamylasparaginylalanylas… ysteinylserylserylcysteinylvalyllysylv… nylaspartyltryptophylleucylvalyllysylp… inylhistidylvalyllysylprolyllysylglycy… lalanylcysteinylaspartylisoleucylalany… inylisoleucyllysyltryptophylphenylalan… lisoleucylprolylalanylglutamylprolylas… mylisoleucylleucylarginylaspartylglycy… ucyllysylisoleucyllysylasparaginylalan… oleucylalanylglutamyltyrosylalanylvaly… ylarginyltyrosylprolylalanyllysylleucy… lglutamylvalylglutamylleucylleucyllysy… ylthreonylisoleucyltyrosylglutamyllysy… ylaspartylalanylglutamylisoleucylseryl… ylglycylglutaminyltryptophyllysylleucy… inylprolylserylprolylthreonylcysteinyl… lglycylglycyllysylarginylphenylalanyll… yllysylleucylaspartylglutaminylalanylg… aminylalanylleucylasparaginylalanyliso… ylleucylthreonylvalyllysylglutamylisol… anylalanylvalylprolylleucyllysylaspart… rginylarginylglutaminylalanylarginylph… cylthreonylarginylglutamylalanylaspara… ysylglycylprolylaspartylisoleucylisole… nylalanylaspartylisoleucylisoleucylala… isoleucylleucylvalylisoleucylasparagin… ylaspartylaspartylglutamylglycylvalylt… utamylglycyllysyllysylthreonylserylala… reonylglycylisoleucylarginylleucyllysy… ucylglutamylaspartylglutaminylthreonyl… eonylalanylthreonylphenylalanylvalylcy… lutamyllysylmethionylhistidylvalylvaly… inylaspartylalanyllysylleucylhistidylt… cylisoleucylserylserylglutamylglycylly… mylmethionyllysylglutamylvalylthreonyl… lglutaminylisoleucyllysylalanylglutami… ylthreonylalanylglutaminylleucyllysylv… lyltyrosylphenylalanylthreonylvalyllys… ylalanylvalylglutamyllysylaspartylglut… teinylglutamylvalylseryllysylaspartylv… lalanyllysylaspartylglycylglutamylglut… lysyltyrosylserylisoleucyllysylalanyla… oleucylleucyllysylisoleucyllysyllysyla… ylglycylglutamyltyrosylvalylcysteinyla… tyllysylthreonyllysylalanylasparaginyl… inylleucylisoleucylglutamylvalylglutam… ylglutamylvalylphenylalanylvalylglycyl… lalanylglutamylisoleucylglutamylleucyl… tidylglycylglutaminyltryptophyllysylle… ylthreonylalanylserylprolylaspartylcys… tamylaspartylglycyllysyllysylhistidyli… ylasparaginylcysteinylglutaminylleucyl… ylvalylserylphenylalanylglutaminylalan… alanylalanylasparaginylleucyllysylvaly… leucylphenylalanylisoleucylthreonylpro… ylphenylalanylglutamyllysylaspartylglu… lcysteinylglutamylvalylserylarginylglu… larginyltryptophylleucyllysylglycylthr… eonylglycylaspartylaspartylarginylphen… laspartylglycylthreonyllysylhistidylse… lalanylalanylphenylalanylglutamylaspar… nylphenylalanylglutamylalanylglutamyla… ycyllysylleucylisoleucylisoleucylgluta… lphenylalanylleucylthreonylprolylleucy… sylglutamyllysylglutamylserylalanylval… leucylserylhistidylaspartylasparaginyl… lphenylalanyllysylasparaginylaspartylg… nylthreonylarginylserylvalylserylmethi… llysylthreonylhistidylserylisoleucylth… ylserylisoleucylaspartylaspartylthreon… lylglutamylalanylmethionylglycylmethio… cylthreonylvalylleucylglutamylglycylas… onylglycyllysylleucylglutaminylasparty… lysylaspartylglutamylvalylisoleucylleu… ucylseryllysylalanylaspartylalanylprol… ysylaspartylglycyllysylglutamylisoleuc… lanylvalylisoleucyllysylthreonylaspart… eucylisoleucylleucyllysyllysylalanylle… ylglutaminyltyrosylthreonylcysteinylas… yllysylthreonylserylglycyllysylleucyla… inylglutamylisoleucyllysylleucylvalyla… lglutamylvalylmethionylglutamylthreony… lalanylglutamylthreonylglutamylisoleuc… eucylhistidylalanylasparaginyltryptoph… nylleucylleucylglutaminylthreonylproly… lysylglutamylglutamylglycyllysylisoleu… stidylasparaginylcysteinylarginylleucy… ycylvalylaspartylphenylalanylglutaminy… erylserylalanylhistidylleucylarginylva… glycylleucylleucylarginylprolylleucyll… nylalanylglycylglutamylthreonylalanylt… lglutamylleucylseryltyrosylglutamylasp… yptophyltyrosylleucyllysylglycyllysyll… yllysylvalylvalylprolylarginylserylglu… ylleucylthreonylleucylarginylaspartylv… ylglycylglutamylvalylglutaminylleucylt… nyllysylthreonylhistidylalanylasparagi… amylprolylprolylvalylglutamylphenylala… laspartylglutaminylthreonylvalylglutam… lvalylleucylglutamylcysteinylglutamylv… alanyllysylvalyllysyltryptophylphenyla… glutamylisoleucylleucyllysylseryllysyl… lanylaspartylglycylarginylvalylarginyl… partylcysteinylthreonylprolylglutamyla… lthreonylcysteinylaspartylalanyllysyla… ylcysteinylasparaginylleucylasparaginy… lglutamylphenylalanylleucylarginylprol… minylvalylarginylglutamyllysylglutamyl… lutamylcysteinylglutamylleucylserylarg… alyllysyltryptophylphenylalanyllysylas… lysyllysylglycyllysyllysyltyrosylaspar… ylalanylvalylarginylisoleucylleucylval… lleucylleucylaspartylaspartylglutamyla… lutamylvalylarginylthreonylalanylargin… lthreonylvalylleucylglutamylglutamylgl… yllysylasparaginylleucylalanylasparagi… mylthreonylaspartylthreonylisoleucylly… lseryllysylprolylglycylalanylglutamylv… glycylaspartylglutamylglutamylisoleucy… inyltyrosylglutamylisoleucylleucylthre… ylisoleucylleucylvalylisoleucylglutami… lutamylaspartylalanylglycylasparaginyl… eucylprolylserylserylarginylthreonylas… tidylglutamylleucylalanylalanylglutamy… lylglutaminylasparaginylleucylglutamyl… yllysylalanylglutamylphenylalanylvalyl… utamylserylphenylalanylprolylvalylglut… laspartyllysylthreonylleucylglutamylse… ylvalylisoleucylalanylaspartylglycylly… llysylaspartylalanylthreonylleucylglut… yltyrosylvalylvalylmethionylvalylglycy… nylhistidylleucylthreonylvalylisoleucy… lvalylvalylprolylleucyllysylaspartylth… aminylglutaminylglutamylvalylvalylphen… lvalylasparaginylthreonylglutamylglycy… enylalanylarginylasparaginylglutamylgl… partylserylseryllysyltyrosylisoleucyli… ylleucylvalyltyrosylthreonylleucylargi… stidylleucylaspartylaspartylglutaminyl… valylserylleucylthreonylasparaginylhis… ylvalyllysylserylalanylalanylasparagin… mylglutamylaspartylleucylarginylisoleu… partylisoleucylglutamylthreonylmethion… nylphenylalanyltryptophylcysteinyllysy… aginylvalylthreonylleucyllysyltryptoph… tamylglutamylvalylprolylphenylalanylas… yrosylarginylvalylaspartyllysyltyrosyl… lisoleucyllysylaspartylcysteinylglycyl… lycylglutamyltyrosylisoleucylvalylthre… ysylserylvalylalanylglutamylleucylleuc… rolylthreonylglutamylphenylalanylvalyl… tylglutaminylthreonylvalylthreonylglut… nylvalylphenylalanylserylcysteinylglut… ylalanylasparaginylvalyllysyltryptophy… inylglutamylisoleucyllysylglutamylglyc… lglutamyllysylaspartylglycylserylisole… soleucyllysylaspartylcysteinylarginyll… nylglutamyltyrosylalanylcysteinylglycy… erylarginylalanylarginylleucylphenylal… rolylvalylglutamylisoleucylisoleucylar… isoleucylleucylglutamylalanylprolylgly… anylleucylalanylglutamylleucylasparagi… alylglutaminyltryptophylleucylarginyla… valylvalylglutaminylglycylaspartyllysy… ylserylglutamylglycyllysylisoleucylhis… ylcysteinylaspartylisoleucyllysylproly… tamyltyrosylarginylphenylalanylisoleuc… lanylarginylalanyllysylleucylglutamyll… soleucyllysylthreonylalanylaspartylglu… rtylvalylglycyllysylprolylleucylthreon… spartylalanyltyrosylprolyllysylalanylg… ylalanyllysylglutamylasparaginylglutam… eonylisoleucylaspartylthreonylthreonyl… ylphenylalanylarginylisoleucylleucylgl… llysylglycylarginyltyrosyllysylisoleuc… ysylhistidylglycyllysylalanylglutamylg… ylleucyllysylvalylisoleucylaspartylval… araginylleucylglutamylvalylthreonylglu… ycylglutamylvalylserylleucylalanyltryp… hreonylaspartylglycylglycylseryllysyli… valylglutamylarginylarginylaspartyliso… tophylvalylleucylalanylthreonylasparty… lglutamylphenylalanylthreonylvalylthre… ylglycylvalylglutamyltyrosylleucylphen… nylasparaginylarginylvalylglycylthreon… threonylaspartylasparaginylprolylvalyl… sylaspartylvalylprolylglycylprolylprol… leucylthreonylaspartylvalylasparaginyl… leucylthreonyltryptophylglutamylprolyl… glycylalanylglutamylisoleucylthreonyla… amylleucylarginylaspartyllysylthreonyl… rtylthreonylalanylmethionylthreonylval… ylserylalanylthreonylvalylthreonylaspa… nylglutamyltyrosylserylphenylalanylarg… araginylarginylisoleucylglycylvalylgly… onylprolylphenylalanylvalyllysylvalyla… larginylprolylserylprolylprolylvalylas… partylglutaminylthreonylglutaminylsery… ptophylglutamylprolylprolylleucyllysyl… eucylleucylglycyltyrosylisoleucylisole… lglutamylglycyllysylaspartylasparaginy… lasparaginylmethionyllysylleucylvalylp… ysylvalylthreonylglycylleucylglutamyll… ucyltyrosylarginylvalylserylalanylglut… ylserylaspartylprolylserylglutamylisol… ylalanylaspartylaspartylalanylphenylal… ionylaspartylleucylserylalanylphenylal… ylvalylisoleucylvalylprolylasparaginyl… cylvalylprolylserylthreonylglycyltyros… threonyltryptophylcysteinylphenylalany… amylthreonylglycylaspartylarginylvalyl… rylalanyltyrosylalanylglutamylleucylva… larginylserylaspartyllysylglycylisoleu… glutamylasparaginylarginylvalyllysylth… soleucylaspartylvalylasparaginylvalyli… nylprolyllysylglutamylleucyllysylpheny… nyllysylaspartylserylvalylhistidylleuc… rolylaspartylaspartylaspartylglycylgly… yrosylvalylvalylglutamyllysylarginylgl… ltryptophylthreonyllysylvalylmethionyl… partylleucylglutamylphenylalanylthreon… taminylglycyllysylglutamyltyrosylleucy… nylarginylasparaginyllysylcysteinylgly… tyrosylvalylaspartylglutamylprolylvaly… rolylalanylthreonylvalylprolylaspartyl… llysyltryptophylarginylaspartylarginyl… ucylphenylalanylleucylthreonyltryptoph… nylaspartylglycylglycylserylarginyliso… lylglutamylarginylcysteinylprolylargin… lvalylalanylcysteinylglycylglutamylpro… methionylglutamylvalylthreonylglycylle… tophyltyrosylalanyltyrosylarginylvalyl… ylglutaminylglycylalanylseryllysylprol… lglutamylisoleucylglutaminylalanylvaly… alanylprolylglutamylisoleucylphenylala… ucylalanylglycylleucylthreonylvalyllys… lglutamylleucylprolylalanylthreonylval… prolyllysylisoleucylthreonyltryptophyl… lisoleucylleucyllysylglutaminylasparty… ucylglutamylasparaginylvalylprolyllysy… leucylvalylaspartylseryllysylarginylse… rosylisoleucylisoleucylglutamylalanylv… arginylalanylthreonylalanylvalylvalylg… spartyllysylprolylglycylprolylprolylal… ucylthreonylaspartylvalylthreonylaspar… eucylthreonyltryptophylasparaginylprol… ylglycylseryllysylisoleucylthreonylasp… ginylarginylalanylthreonylaspartylsery… ylleucylserylserylthreonylvalyllysylas… yllysylalanylthreonyllysylleucylisoleu… rosylisoleucylphenylalanylarginylvalyl… ionyltyrosylglycylalanylglycylglutamyl… lylisoleucylthreonylalanyllysyltyrosyl… lprolylglycylprolylprolylthreonylargin… isoleucylthreonyllysylaspartylalanylva… cysteinylglutamylprolylaspartylasparty… leucylthreonylglycyltyrosyltryptophylv… olylaspartylthreonylaspartyllysyltrypt… yllysylmethionylprolylvalyllysylaspart… yllysylglycylleucylthreonylasparaginyl… alanylarginylvalylleucylalanylglutamyl… glycyllysylprolylseryllysylserylthreon… eucyllysylaspartylprolylisoleucylaspar… ylglycyllysylprolylthreonylvalyllysyla… lvalylarginylleucylasparaginyltryptoph… ylaspartylglycylglycylalanyllysylisole… cylglutamylmethionylleucyllysylthreony… tophylvalylarginylvalylalanylglutamylg… taminylhistidylleucylleucylprolylglycy… minylglutamyltyrosylserylphenylalanyla… ginyllysylalanylglycylglutamylserylglu… aspartylprolylvalylleucylcysteinylargi… prolylserylprolylprolylarginyltryptoph… aginylisoleucylthreonyllysylasparaginy… ryptophylthreonylvalylprolylglutamylly… soleucylthreonylasparaginyltyrosylisol… tylvalylarginylarginyllysylglycyltrypt… lthreonylthreonylvalyllysylaspartylthr… eonylprolylleucylthreonylglutamylglycy… larginylvalylalanylalanylglutamylaspar… ylserylaspartyltyrosylthreonylglutamyl… leucylalanyllysylaspartylthreonylpheny… prolylprolyltyrosylalanylleucylalanylv… arginylhistidylvalylaspartylleucyllysy… lasparaginylaspartylglycylglycylarginy… rosylvalylisoleucylglutamyllysyllysylg… rginyltryptophylvalyllysylalanylglycyl… rtylcysteinylasparaginylphenylalanylar… eucylglutamylglycylthreonylglutamylval… alylarginylalanylglutamylasparaginylgl… ylprolylserylglutamylprolylthreonylglu… lutamylaspartylprolylthreonylserylprol… rtylleucylhistidylvalylthreonylasparty… oleucylalanylisoleucylalanyltryptophyl… aginylglycylglycylserylprolylisoleucyl… glutamylmethionylcysteinylprolylvalylg… lmethionylarginylvalylasparaginylseryl… leucyllysylphenylalanyllysylvalylgluta… partyllysylglutamyltyrosylvalylleucyla… ginylalanylisoleucylglycylvalylserylgl… erylglutamylasparaginylvalylvalylalany… yllysylprolylthreonylisoleucylaspartyl… tylisoleucylisoleucylvalylisoleucylglu… isoleucylprolylvalylprolylphenylalanyl… threonylvalylseryltryptophylhistidylly… lysylalanylserylaspartylarginylleucylt… artylhistidylisoleucylserylalanylhisti… rylvalylarginylalanylaspartylalanylgly… lthreonylleucylglutamylasparaginyllysy… nylserylisoleucylasparaginylvalyllysyl… cylprolylcysteinyllysylaspartylisoleuc… threonyllysylserylserylcysteinyllysyll… ylprolylglutamylphenylalanylaspartylgl… ucylhistidyltyrosylvalylleucylglutamyl… rginylarginylthreonyltyrosylisoleucylp… mylasparaginyllysylleucylseryltryptoph… soleucylprolylasparaginylglycylglutamy… inylvalyllysylalanylvalylasparaginylly… yrosylisoleucylglutamylleucyllysylaspa… utaminylaspartylprolyllysylglutaminylp… laspartylvalylglutamylvalylhistidylasp… lalanylmethionylthreonylisoleucylthreo… ltyrosylaspartylglycylglycylseryllysyl… eucylisoleucylglutamyllysylisoleucylal… nyltryptophyllysylarginylcysteinylaspa… rolylisoleucylleucylthreonyltyrosylthr… lglutamylglycyllysylglutamyltyrosylglu… nylalanylglutamylasparaginylalanylalan… lserylarginylalanylthreonylprolylproly… olylisoleucylaspartylalanylprolyllysyl… serylleucylglutamylvalyllysylarginylgl… leucylaspartylalanylserylisoleucylsery… onylisoleucylthreonyltryptophylisoleuc… alylisoleucylvalylprolylglutamylglutam… lanylprolylleucylvalylarginylarginylar… inylglutamylglutamylglutamylprolylphen… onylglutaminylarginylleucylserylisoleu… ylglycylglutamylserylglutaminylleucyla… ylarginylprolylaspartylhistidylglycyll… valylglutamylasparaginylaspartylhistid… rolylcysteinylthreonylvalylserylvalyll… olylprolylisoleucylasparaginylphenylal… ylisoleucylarginyllysylthreonylserylva… utamylprolylprolylleucylaspartylaspart… lisoleucylasparaginyltyrosylthreonylle… threonyllysylprolylaspartylserylglutam… onylserylthreonylleucylarginylhistidyl… onyllysylleucylisoleucylglutamylglycyl… nylarginylvalylarginylalanylglutamylas… rolylglycylprolylprolylcysteinylvalyls… ylaspartylprolylphenylalanylglycylprol… llysylprolylisoleucylvalylglutamylaspa… rylmethionylleucylvalyllysyltryptophyl… tylasparaginylglycylserylprolylisoleuc… ylglutamyllysylarginylglutamylvalylasp… phylserylarginylvalylasparaginyllysyls… ucyllysylalanylasparaginylvalylasparty… ucylthreonyltyrosylvalylphenylalanylar… paraginylalanylalanylglycylprolylglycy… serylaspartylprolyllysylthreonylalanyl… lprolylprolylglycylprolylprolylisoleuc… lthreonylserylserylthreonylthreonyliso… hylglutamylprolylprolylalanylphenylala… tamylisoleucylvalylglycyltyrosylphenyl… eucylvalylglycylthreonylasparaginyllys… reonylglutamyllysylmethionylisoleucyll… reonylvalyllysylglutamylisoleucylargin… yllysylleucylarginylvalylserylalanylva… tamylglycylprolylprolylglycylglutamylt… lvalylalanylglutamylprolylglutaminylgl… ylleucylaspartylvalylserylvalyllysylgl… cylmethionylalanylglycyllysylthreonyll… lylvalylthreonylglycylarginylprolylval… lthreonyllysylglutamylglutamylglycylgl… ginylvalylvalylisoleucylaspartylaspara… lutamylleucylisoleucylisoleucyllysylas… tylhistidylglycylarginyltyrosylvalylis… ginylserylcysteinylglycylseryllysylphe… alylglutamylvalylphenylalanylaspartylv… partylleucyllysylprolylvalylvalylthreo… cysteinylleucylleucylasparaginyltrypto… rtylaspartylglycylglycylserylglutamyli… soleucylisoleucylglutamylarginyllysyla… threonyltryptophylarginylglutaminylpro… larginylseryllysylcysteinylaspartyliso… tamylglycylglutaminylglutamyltyrosylly… lalanyllysylasparaginyllysylphenylalan… valylglutamylisoleucylglycylprolylisol… lleucylglycylprolylprolylthreonylseryl… tyrosylthreonylglutamylarginylglutamin… onylleucylaspartyltryptophyllysylgluta… cylglycylserylprolylisoleucylglutaminy… tamyllysylarginylarginylhistidylaspart… utamylarginylvalylasparaginyllysylargi… eonylserylphenylalanylleucylvalylgluta… lhistidylglutaminylmethionyltyrosylglu… lanylvalylasparaginylglutamylisoleucyl… rylleucylprolylleucylasparaginylvalylv… rtylglutamylvalylprolylprolylthreonyli… ylvalylarginylglycylaspartylthreonylis… lutamylprolylvalylhistidylisoleucylpro… lleucylprolylmethionylprolyllysylisole… araginylglutamylthreonylvalylisoleucyl… alanylleucylglutaminylisoleucylthreony… inylserylglutamylalanyllysylthreonylgl… ylalanylvalylarginylglutamylaspartylly… ylthreonylalanylserylasparaginylarginy… arginylasparaginylvalylhistidylvalylgl… olylserylprolylprolylarginylasparaginy… soleucyllysylalanylglutamylserylcystei… spartylalanylprolylleucylaspartylaspar… eucylthreonylhistidyltyrosylvalylisole… nylserylarginyllysyllysylalanylglutamy… eonylasparaginylthreonylalanylvalylglu… ucyltryptophyllysylleucylisoleucylprol… lglutamylphenylalanylarginylvalylargin… lglycylisoleucylserylaspartylglutamylc… lvalylisoleucylglutaminylaspartylproly… olylprolylglycyllysylprolyllysylvalyll… ylserylmethionylleucylvalylseryltrypto… tylasparaginylglycylglycylserylprolyli… phylleucylglutamyllysylarginylglutamyl… ptophylserylarginylvalylserylarginylal… ylglycylleucyllysylglycylvalylglutamyl… rginylleucylleucylglutamylglycylvalyll… ginylalanylmethionylalanylisoleucylasp… glycylprolylprolylserylglutamylprolyls… ylglycylaspartylprolylisoleucylphenyla… serylcysteinylprolylglutamylvalyllysyl… lisoleucylserylleucylglycyltryptophyll… glycylglycylserylprolylisoleucyllysylg… ethionylglutaminylglutamylglutamylglyc… llysylarginylvalylasparaginylglutamylp… reonylthreonylcysteinylglutamylcystein… lysylglutamylleucylarginyllysyltyrosyl… lalanylvalylasparaginylglutamylalanylg… ylaspartylthreonylthreonylglycylglutam… rtylisoleucylglutaminylglutamylglutamy… leucylaspartylisoleucylglycylalanylglu… cysteinyllysylalanylglycylserylglutami… lanylvalylisoleucyllysylglycylarginylp… ryptophylglutamylphenylalanylaspartylg… hionyllysylaspartylglycylvalylhistidyl… rtylalanylglutaminylleucylglutamylthre… erylvalylisoleucylisoleucylisoleucylpr… rylhistidylthreonylglycyllysyltyrosyls… araginyllysylalanylglycylglutaminyllys… larginylvalyllysylvalylmethionylaspart… laspartylleucyllysylvalylserylaspartyl… cysteinylarginylleucylseryltryptophyll… aspartylglycylglycylaspartylarginyliso… cylglutamyllysylarginylthreonylisoleuc… ylthreonyllysylvalylasparaginylprolyla… threonylphenylalanylvalylvalylprolylas… aminylglutaminyltyrosylphenylalanylphe… lutamylasparaginylarginylphenylalanylg… ylglutamylthreonylisoleucylglutaminyla… aspartylprolylisoleucyltyrosylprolylpr… sylleucyllysylisoleucylglycylleucyliso… nylvalylhistidylleucylseryltryptophyll… artylglycylglycylserylprolylvalylthreo… tamylcysteinylleucylalanyltryptophylas… ysyllysylglutamylalanyltryptophylargin… ylarginylaspartylvalylglutamylglutamyl… lvalylglutamylaspartylleucylvalylgluta… mylphenylalanylarginylvalyllysylalanyl… alylseryllysylprolylserylalanylthreony… cysteinylglutaminylarginylprolylaspart… ylaspartylleucyllysylglutamylphenylala… utamylglycylthreonylasparaginylvalylas… soleucyllysylglycylvalylprolylphenylal… ptophylphenylalanyllysylalanylprolylpr… inyllysylglutamylprolylvalylleucyltyro… araginyllysylleucylvalylvalylaspartyla… cylvalylisoleucylprolylglutaminylseryl… glycylleucyltyrosylthreonylisoleucylth… inylleucylglycylthreonylalanylseryllys… araginylvalylleucylglycylarginylprolyl… isoleucyllysylphenylalanylglutamylsery… methionylthreonylleucylseryltryptophyl… ylaspartylglycylglycylseryllysylisoleu… soleucylglutamyllysylarginylglutamylal… tryptophylvalylhistidylvalylserylseryl… lthreonyltyrosylthreonylisoleucylproly… tidylglutamyltyrosylvalylphenylalanyla… minylasparaginyllysyltyrosylglycylisol… rtylserylglutamylprolylglutamylthreony… ylalanylserylvalylprolylglycylalanylpr… lserylserylvalylthreonylarginylasparag… raginyltryptophylglutamylglutamylproly… lserylprolylvalylthreonylglycyltyrosyl… sylaspartylthreonylthreonylseryllysyla… paraginylarginylaspartylprolylisoleucy… glycylvalylseryltyrosyllysylvalylthreo… cylserylaspartyltyrosylglutaminylpheny… leucylasparaginylalanylalanylglycylval… ylserylaspartylprolylalanylthreonylala… anylprolylprolylglycylprolylprolylphen… artyltryptophylthreonyllysylserylseryl… hylserylprolylprolylleucyllysylasparty… lglycyltyrosylisoleucylvalylglutamylty… ylglutamylglutamyltryptophylglutamylly… valylarginylglycylthreonyllysylleucylv… lutamylglycylalanylphenylalanyltyrosyl… lanylvalylasparaginylisoleucylalanylgl… ycylglutamylvalylthreonylaspartylvalyl… rtylarginylleucylvalylserylprolylaspar… anylserylvalylarginylaspartylarginylis… ylglycylvalylisoleucylarginylisoleucyl… cyllysylprolylprolylprolylthreonylvaly… onylasparaginylglutamylarginylthreonyl… lthreonylisoleucylglutamylthreonylthre… ethionylvalylisoleucyllysylasparaginyl… idylglutaminylglycylvalyltyrosylseryll… utamylalanylglycylglutamylarginyllysyl… laspartylvalylleucylaspartylvalylproly… lylphenylalanylleucylalanylhistidylasp… utamylserylcysteinyllysylleucylthreony… lutamylaspartylaspartylglycylglycylser… ltyrosylvalylisoleucylglutamyllysylarg… inylalanyltryptophylthreonylprolylvaly… ylarginylglutaminylasparaginylalanylth… oleucylglutaminylglycyllysylalanyltyro… soleucylalanylalanylglutamylasparaginy… lprolylphenylalanylvalylglutamylthreon… leucylarginylglutamylprolylisoleucylth… lylglutamylaspartylleucylglutamylvalyl… raginylthreonylvalylthreonylleucylthre… yllysyltyrosylaspartylglycylglycylsery… nyltyrosylvalylleucylglutamylserylargi… tamyllysylphenylalanylhistidyllysylval… ginylleucylleucylserylarginyllysyltyro… sylglutamylglycylaspartylthreonyltyros… lanylvalylasparaginylisoleucylvalylgly… phenylalanylcysteinylthreonyllysylprol… partylglutamylleucylalanylprolylprolyl… lphenylalanylarginylaspartyllysylleucy… lglutamylalanylphenylalanylalanylleucy… lycyllysylprolyllysylprolyllysylvalyls… rtylglutamylalanylaspartylvalylleucylg… nylhistidylisoleucyllysylthreonylthreo… leucylglutamyllysylisoleucyllysylalany… yllysyltyrosylcysteinylvalylvalylvalyl… cylserylarginyllysylglycylphenylalanyl… valylvalylaspartylhistidylprolylglycyl… erylphenylalanylaspartylglutamylvalylt… lvalylisoleucylseryltryptophyllysylpro… ylglycylseryllysylisoleucylthreonylasp… utamyllysyllysylglutamylvalylglycyllys… rolylvalylthreonylserylalanylserylalan… ylvalylseryllysylleucylleucylglutamylg… henylalanylarginylisoleucylhistidylala… glycylisoleucylserylaspartylprolylleuc… ysylalanyllysylaspartylarginylphenylal… lprolylaspartylglutaminylprolylisoleuc… llysylaspartylserylalanylleucylvalylth… lylhistidylaspartylglycylglycyllysylpr… osylisoleucylleucylglutamyllysylarginy… larginyltryptophylalanylarginylvalylth… istidylprolyltyrosylthreonyllysylpheny… ucylleucylglutamylglycylcysteinylgluta… inylvalylserylalanylglutamylasparaginy… ycylaspartylprolylserylprolylprolylser… llysylaspartylprolylisoleucylalanyllys… aginylprolylglutamylalanylisoleucylasp… aginylserylvalylaspartylleucylthreonyl… inylhistidylaspartylglycylglycylseryll… leucylvalylglutamyltyrosylglutaminylly… myltryptophylarginylarginylalanylaspar… lserylcysteinylprolylglutamylthreonyll… leucylarginylaspartylglycylglutaminylt… nylvalylleucylalanylvalylasparaginylal… ylprolylalanylhistidylvalylprolylgluta… tylarginylleucylglutamylprolylprolylgl… alanylasparaginylmethionylalanylarginy… llysylvalylglycylaspartylthreonylleucy… soleucyllysylglycylvalylprolylphenylal… hyllysyllysylglutamylaspartylarginylas… ylarginylisoleucylaspartylvalylthreony… lutamylisoleucylarginylasparaginylalan… cylglycylisoleucyltyrosylserylleucylth… lalanylglycylseryllysylthreonylvalylse… aspartyllysylprolylglycylprolylprolyla… rylglutamylisoleucylarginyllysylaspart… yltryptophyllysylglutamylprolylleucyla… ylisoleucylthreonylasparaginyltyrosylv… rtylvalylalanylserylalanylglutaminyltr… lthreonylseryllysyllysyllysylserylhist… leucylasparaginylglutamylglycylasparag… anylarginylvalylalanylalanylglutamylas… inylglycylprolylphenylalanylvalylgluta… yllysylalanylleucylaspartylprolylleucy… olyllysylaspartylleucylhistidylhistidy… eonylglutamylvalylserylleucylvalyltryp… larginylaspartylglycylglycylserylproly… ylvalylglutamyltyrosylglutaminylglutam… spartyltryptophylisoleucyllysylphenyla… raginylleucylglutamylcysteinylvalylval… taminylglycyllysylthreonyltyrosylargin… ylglutamylasparaginylisoleucylvalylgly… threonylthreonylisoleucylprolylisoleuc… yllysylleucylvalylprolylprolylserylval… eucylisoleucylglutamylglycylleucylvaly… onylvalylarginylphenylalanylprolylalan… lylprolylvalylprolylthreonylalanyllysy… glycylserylglutamylisoleucyllysylthreo… hreonylvalylglutamylthreonylaspartylas… lleucylthreonylisoleucyllysylasparagin… rtylthreonylglycylglutamyltyrosylgluta… araginylalanylalanylglycylseryllysylth… lthreonylvalylleucylaspartylvalylproly… olylisoleucylasparaginylisoleucylleucy… lhistidylmethionylthreonylisoleucylser… ysylaspartylaspartylglycylglycylserylp… ylisoleucylvalylglutamyllysylglutaminy… ylthreonyltryptophylglycylvalylvalylse… yllysylleucyllysylisoleucylprolylhisti… inylglutamyltyrosylvalylphenylalanylar… raginyllysylisoleucylglycylvalylglycyl… onylprolylthreonylvalylalanyllysylhist… lylserylprolylprolylglycyllysylprolylv… hreonylglutamylasparaginylalanylalanyl… lleucylprolyllysylserylaspartylglycylg… ycyltyrosyltyrosylmethionylglutamylarg… cyllysyltryptophylvalylarginylvalylasp… lalanylaspartylleucyllysylphenylalanyl… osylglutamylglycylasparaginylthreonylt… lylphenylalanylalanylglutamylasparagin… lprolylserylprolylserylserylaspartylpr… ginylprolylisoleucyllysylprolylprolylg… ylprolyllysylleucyllysylaspartyllysyls… partylleucylvalyltryptophylthreonyllys… ycylserylprolylisoleucylleucylglycylty… taminyllysylprolylglycylthreonylalanyl… nylisoleucylasparaginyllysylaspartylgl… nylcysteinylalanylphenylalanylarginylv… amylglycylasparaginylglutamyltyrosylar… sylalanylalanylasparaginylisoleucylval… larginylglutamylleucylalanylglutamylse… lisoleucylleucylhistidylprolylprolylgl… lylthreonylcysteinylarginylaspartylval… lglycylglutaminylthreonylisoleucylargi… llysylglycylarginylprolylglutamylproly… lthreonyllysylglutamylglycyllysylvalyl… nylvalylaspartylleucylisoleucylglutami… glutamylleucylglutaminylisoleucyllysyl… artylhistidylglycyllysyltyrosylisoleuc… nylserylserylglycylhistidylalanylgluta… lasparaginylvalylleucylaspartylarginyl… ylasparaginylleucyllysylvalylthreonyla… lasparaginylcysteinylthreonylisoleucyl… rolylleucylaspartylasparaginylglycylgl… sparaginylphenylalanylisoleucylvalylgl… raginylglutaminyllysylglycyltryptophyl… tylvalylthreonyllysylarginylleucylisol… ucylalanylasparaginylasparaginylglutam… valylcysteinylalanylglutamylasparaginy… hreonylisoleucylglutamylthreonyllysylt… soleucylasparaginylprolylisoleucylaspa… ylglutamylasparaginylleucylhistidyliso… lthreonylphenylalanylvalyltyrosylleucy… laspartyltyrosylaspartylglycylglycylse… sylhistidylvalylglutamylarginylarginyl… tyltryptophylglutamylarginylvalylhisti… utamylthreonylhistidyltyrosylmethionyl… lutamylasparaginylglutaminylisoleucylt… lylglutaminylthreonyllysylasparaginylg… artyltryptophylvalyllysylthreonylgluta… amylaspartylleucylglutaminyllysylproly… ylserylglycylvalylleucylthreonylvalyll… leucylarginylleucylglutamylalanylglycy… lalanylprolylglutamylvalylalanyltrypto… tylalanylthreonylaspartylleucylthreony… lisoleucylaspartylthreonylarginylalany… lserylleucylthreonyllysylalanyllysylar… tyrosylvalylvalylthreonylalanylthreony… ylphenylalanylvalylalanyltyrosylalanyl… aspartyllysylprolylglycylprolylvalylar… lvalylaspartylvalylserylserylaspartyla… yltryptophylaspartylprolylprolylglutam… inylglutamylisoleucylglutaminylasparag… ysylcysteinylglutamylthreonyllysylargi… eonyltyrosylserylalanylthreonylvalylle… eonylvalylthreonylarginylleucylisoleuc… tyrosylisoleucylphenylalanylarginylval… ysylisoleucylglycylthreonylglycylproly… olylvalylisoleucylalanyllysylthreonyll… larginylprolylaspartylprolylprolylglut… ylglutamylglutamylmethionylthreonylval… rolylglutamyltyrosylaspartylglycylglyc… tyrosylphenylalanylleucylglutamyllysyl… onylarginyltryptophylvalylprolylvalyla… prolylglutamylarginylarginylmethionyll… lleucylprolylaspartylhistidylglutamylt… valyllysylalanylglutamylasparaginylglu… glutamylprolylserylleucylprolylserylar… artylprolylisoleucylglutamylprolylprol… inylphenylalanylarginylvalylvalylaspar… ylisoleucylthreonylleucylglycyltryptop… artylglycylglycylalanylprolylisoleucyl… tamylmethionylarginylprolyllysylisoleu… spartylglutamylglycyltryptophyllysylar… ylalanylglutaminylleucylvalylarginylly… lthreonylserylleucylaspartylglutamylas… lutamylphenylalanylarginylvalylcystein… inylvalylglycylisoleucylglycylarginylp… mylalanylisoleucyllysylprolyllysylglut… olylglutamylisoleucylaspartylleucylasp… ylleucylvalylisoleucylvalylarginylalan… inylleucylphenylalanylalanylisoleucylv… lprolyllysylvalylthreonyltryptophylarg… ylasparaginylvalylvalylarginyllysylgly… ylaspartylthreonylmethionylalanylpheny… paraginylserylthreonylarginylaspartyla… leucylthreonylleucylvalylasparaginylpr… valylphenylalanylvalylasparaginylvalyl… rolylglycylprolylvalylserylaspartylleu… onyllysylthreonylserylcysteinylhistidy… olylglutamylasparaginylaspartylglycylg… stidyltyrosylisoleucylvalylglutamyllys… nyllysylthreonyltryptophylserylthreony… syllysylthreonylserylphenylalanylhisti… lylprolylglycylasparaginylglutamyltyro… hreonylalanylvalylasparaginylglutamylt… threonylaspartylvalylprolyllysylprolyl… lleucylserylglutamylprolylaspartylprol… lanylthreonylglutamylmethionylthreonyl… leucylalanyltryptophylleucylprolylprol… alanyllysylisoleucylaspartylglycyltyro… ginylglutamylglutamylglutamylglutaminy… hylthreonylglutamyltyrosylserylvalylva… lylvalylthreonylglycylleucyllysylgluta… ylalanylarginylvalylalanylalanylarginy… erylleucylprolylarginylglutamylalanylg… anyllysylglutamylglutaminylleucylleucy… thionylprolylglutamylglutaminylisoleuc… llysyllysylleucylarginylisoleucylgluta… lysylprolylhistidylprolylthreonylcyste… glutamylaspartylglutamylvalylvalylthre… alylhistidyllysylalanylaspartylserylse… leucyllysylaspartylvalylthreonylarginy… osylserylleucylthreonylalanylglutamyla… spartylthreonylglutaminyllysylisoleucy… tylalanylprolylglycylprolylprolylgluta… ylisoleucylserylaspartylisoleucylaspar… ylleucylseryltryptophylhistidylisoleuc… lglycylserylasparaginylisoleucylthreon… lutamyllysylcysteinylaspartylvalylsery… ylthreonylalanylleucylalanylserylvalyl… arginylvalylglycyllysylleucylisoleucyl… ylisoleucylphenylalanylarginylvalylarg… lphenylalanylglycylisoleucylserylgluta… ysylmethionylvalylalanylglutaminylphen… ylprolylserylglutamylprolyllysylaspara… lvalylasparaginyllysylaspartylcysteiny… yptophylaspartylarginylprolylaspartyls… isoleucylisoleucylglycyltyrosylleucyli… larginylasparaginylserylleucylleucyltr… aspartylthreonylleucylvalylarginylsery… inylalanylglycylleucylvalylglutamylgly… alanylarginylisoleucyltyrosylalanylleu… lserylprolylprolylseryllysylprolylthre… nylarginylmethionylprolylvalylaspartyl… ylvalylisoleucylaspartylvalylthreonyll… oleucyltryptophylalanylarginylprolylly… llysylisoleucylisoleucylglycyltyrosylp… inyllysylleucylprolylglycylaspartyllys… paraginylthreonylalanylprolylhistidylg… lutamylglutamyltyrosylthreonylalanylth… ysylalanylglutaminyltyrosylglutaminylp… anylarginylthreonylalanylvalylasparagi… lutamylprolylserylaspartylprolylvalylt… lasparaginylvalylprolylprolylarginylis… ylmethionyllysylserylleucylleucylthreo… paraginylvalylcysteinylleucylaspartyla… llysylprolylmethionylprolylthreonylval… glycylthreonylleucylleucyllysylprolyla… thionylalanylmethionylglutaminylarginy… leucylglutamylleucylphenylalanylserylv… serylglycylaspartyltyrosylthreonylisol… nylserylserylglycylseryllysylserylalan… valylleucylaspartyllysylprolylglycylpr… eucylasparaginyllysylmethionyltyrosyls… eucylseryltryptophylglutamylprolylprol… lserylglutamylisoleucylthreonylasparag… sylarginylglutamylthreonylserylarginyl… utaminylvalylserylalanylthreonylvalylp… lserylvalylglutamyllysylleucylisoleucy… sylglutaminylphenylalanylarginylisoleu… yllysyltyrosylglycylvalylglycylasparty… tamylprolylalanylisoleucylalanyllysyla… ylprolylglycylarginylcysteinylaspartyl… raginylisoleucylthreonyllysylaspartylh… ryptophyllysylprolylprolylalanylaspart… oleucylthreonylglycyltyrosylleucylleuc… nylglutaminylalanylvalylasparaginyltry… larginyllysylprolylisoleucylisoleucylg… anylthreonylglycylleucylglutaminylglut… utamylphenylalanylarginylvalylthreonyl… ylglycylprolylglycyllysylprolylserylas… yrosylalanylarginylaspartylprolylgluta… lprolylalanylphenylalanylprolyllysylva… rginylserylserylvalylserylleucylserylt… osylaspartylglycylglycylserylprolyliso… alylglutamylvalyllysylarginylalanylasp… phylvalylarginylcysteinylasparaginylle… ylglutaminyllysylthreonylarginylphenyl… ucylmethionylglutamylaspartylthreonylg… nylarginylvalyltyrosylalanylvalylaspar… rylaspartylprolylserylaspartylvalylpro… yllysylaspartylisoleucylleucylisoleucy… histidylaspartylalanylaspartylleucylar… ucylarginylalanylglycylvalylthreonylme… lylvalyllysylglycylarginylprolylprolyl… hylseryllysylprolylasparaginylvalylasp… lisoleucylglycylleucylaspartylisoleucy… anylaspartylthreonylphenylalanylleucyl… valylasparaginyllysyltyrosylaspartylal… ylthreonylleucylglutamylasparaginylser… tyrosylthreonylisoleucylvalylvalyllysy… lycylprolylprolylisoleucylasparaginylv… ucylseryllysylaspartylserylalanyltyros… olylprolylisoleucylisoleucylaspartylgl… ucylasparaginyltyrosylvalylvalylglutam… mylarginyllysylseryltryptophylserylthr… ysteinylseryllysylthreonylserylphenyla… eucylglutamylglutamylglycyllysylserylt… ylvalylphenylalanylalanylglutamylaspar… lglycylaspartylprolylglycylglutamylthr… lalanylserylglutaminylthreonylprolylgl… ysylvalylarginylserylvalylseryllysylse… yltryptophyllysyllysylprolylhistidylse… isoleucylisoleucylglycyltyrosylvalylva… ylglutamylglutamylasparaginyllysyltryp… yllysylserylleucylserylleucylglutaminy… cylthreonylglutamylglycyllysylglutamyl… alylserylalanylglutamylasparaginylglut… threonylprolylserylglutamylisoleucylth… ylaspartylvalylvalylalanylprolylaspart… ucylprolylaspartylleucylcysteinyltyros… nylserylasparaginylphenylalanylarginyl… lysylglycyllysylprolylalanylprolylsery… ylglutamylaspartylprolylleucylalanylth… erylvalylglutamylserylserylalanylvalyl… oleucylvalyltyrosylaspartylcysteinylgl… cyllysyltyrosylthreonylisoleucylthreon… glycylthreonyllysylglutamylglycylthreo… lvalylglycyllysylprolylglycylisoleucyl… lysylphenylalanylaspartylglutamylvalyl… ylthreonylleucyllysyltryptophylalanylp… cylglycylserylglutamylisoleucylthreony… lutamyllysylarginylaspartylserylvalyla… lvalylthreonylcysteinylalanylserylalan… nylphenylalanylarginylvalylthreonylarg… hionylglutamyltyrosylthreonylphenylala… sparaginyllysyltyrosylglycylvalylglycy… amylprolylisoleucylvalylalanylarginylh… lylprolylaspartylalanylprolylprolylpro… spartylvalylarginylhistidylaspartylser… lthreonylaspartylprolyllysyllysylthreo… threonylglycyltyrosylhistidylleucylglu… ylasparaginylserylleucylleucyltryptoph… lthreonylprolylisoleucylarginylmethion… alylthreonylglycylleucylthreonylglutam… ylphenylalanylarginylvalylmethionylala… glycylvalylglycyllysylprolylserylleucy… lalanylleucylaspartylprolylisoleucylas… glutamylvalylisoleucylasparaginylisole… valylthreonylleucylisoleucyltryptophyl… spartylglycylglycylhistidyllysylleucyl… glutamyllysylarginylaspartylleucylprol… llysylalanylasparaginylhistidylvalylas… ylalanylphenylalanylthreonylvalylthreo… lglycyllysyltyrosylglutamylphenylalany… asparaginylthreonylalanylglycylalanyli… mylserylthreonylglutamylthreonylisoleu… lutamyltyrosylglutamylalanylprolylthre… lylthreonylisoleucyllysylaspartylglycy… glycylaspartylthreonylisoleucylvalylle… isoleucylleucylglycyllysylprolylleucyl… llysylalanylglycyllysylaspartylisoleuc… ylthreonylglutaminylisoleucylthreonyls… lmethionylleucylthreonylisoleucyllysyl… partylalanylglycylglutamyltyrosylthreo… sparaginylprolylphenylalanylglycylthre… lysylvalylthreonylvalylleucylaspartylv… rolylvalylglutamylisoleucylserylaspara… lanylthreonylleucylthreonyltryptophylt… partylglycylglycylserylprolylisoleucyl… tamyllysylarginylglutamylthreonylseryl… ylvalylvalylserylglutamylaspartylisole… histidylvalylalanylthreonyllysylleucyl… lglutamyltyrosylisoleucylphenylalanyla… nylhistidyltyrosylglycyllysylglycylglu… amylprolylvalyllysylmethionylvalylaspa… prolylglycylprolylprolylglutamyllysylp… alylthreonyllysylasparaginylthreonylal… ylarginylprolylvalylaspartylaspartylgl… eonylglycyltyrosylhistidylvalylglutamy… rylleucylarginyltryptophylvalylarginyl… alylserylaspartylleucylarginylcysteiny… aminylglutamylglycylserylthreonyltyros… erylalanylglutamylasparaginylarginylal… ylserylglutamylalanylserylaspartylsery… lanylalanyltyrosylprolylprolylglycylpr… tidylvalylthreonylaspartylthreonylthre… lalanyltryptophylglycyllysylprolylhist… ylglutamylisoleucylthreonylglycyltyros… nyllysylvalylglycylaspartylglutamylala… threonylthreonylglycylthreonylalanylle… nylphenylalanylvalylvalylprolylasparty… myllysyltyrosylasparaginylphenylalanyl… lasparaginylaspartylalanylglycylvalylg… ucylprolylaspartylvalylglutamylisoleuc… onylalanylprolylaspartylphenylalanylgl… eucylarginylarginylthreonylleucylvalyl… isoleucylarginylisoleucylphenylalanylv… ylprolylalanylprolylglutamylvalylthreo… sparaginylisoleucylasparaginylleucylly… nylisoleucylglutamylasparaginylthreony… eucylleucylisoleucylisoleucylprolylglu… osylaspartylthreonylglycyllysylphenyla… lglutamylasparaginylprolylalanylglycyl… lylasparaginylvalylarginylvalylleucyla… lylleucylasparaginylleucylarginylproly… ysylaspartylserylvalylthreonylleucylhi… lleucylisoleucylaspartylglycylglycylse… nyltyrosylisoleucylvalylglutamyllysyla… lysylseryltyrosylserylthreonylalanylth… llysylcysteinylthreonyltyrosyllysylval… glycylcysteinylglutamyltyrosylphenylal… ylalanylglutamylasparaginylglutamyltyr… olylthreonylglutamylthreonylthreonylgl… utamylalanylprolylserylprolylprolylasp… lmethionylaspartylisoleucylthreonyllys… yltryptophylprolyllysylprolyllysylhist… soleucylthreonylglycyltyrosylvalylisol… llysylglycylserylaspartylglutaminyltry… eonylthreonylvalyllysylglycylleucylglu… raginylleucylthreonylglutamylglycylglu… lanylglutaminylvalylmethionylalanylval… ylserylalanylprolylarginylglutamylsery… sylglutamylglutaminylthreonylmethionyl… eucylarginylglycylisoleucyltyrosylglut… yllysylalanylglycylaspartylasparaginyl… lprolylvalylleucylglycylarginylprolyll… tophyllysyllysylglycylaspartylglutamin… eonylglutaminylarginylvalylasparaginyl… lalanylthreonylserylthreonylisoleucyll… lglutamylcysteinylvalylarginylserylasp… leucylthreonylalanylarginylasparaginyl… ycylaspartylvalylisoleucylthreonylisol… lisoleucylprolylglycylprolylprolylthre… lalanylaspartylglutamylvalylserylseryl… enylalanylseryltryptophylaspartylproly… lycylglycylvalylprolylisoleucylserylas… ethionylarginylglutaminylthreonylaspar… alylglutamylleucylalanylthreonylthreon… onyltyrosyllysylalanylthreonylarginyll… utamyltyrosylglutaminylphenylalanylarg… aginylarginyltyrosylglycylvalylglycylp… anyltryptophylisoleucylvalylalanylaspa… ylvalylprolylglycylprolylprolylglycylt… lalanylvalylthreonyllysylaspartylseryl… tophylhistidylglutamylprolylleucylsery… leucylleucylglycyltyrosylhistidylvalyl… asparaginylglycylisoleucylleucyltrypto… ylalanylleucylvalylprolylglycylasparag… serylglycylleucylthreonylaspartylglycy… ylalanylarginylvalylisoleucylalanylglu… yllysylseryllysylprolylseryllysylproly… alanylleucylaspartylprolylisoleucylasp… alylprolylleucylasparaginylisoleucylth… hreonylleucyllysyltryptophylalanyllysy… lglycylphenylalanyllysylisoleucylthreo… yllysylarginylaspartylleucylprolylaspa… llysylalanylasparaginylphenylalanylser… lasparaginylglutamylphenylalanylthreon… tamylaspartylalanylalanyltyrosylglutam… alanyllysylasparaginylalanylalanylglyc… erylglutamylprolylserylaspartylalanyli… artylaspartylvalylglutamylalanylprolyl… yllysylphenylalanyllysylaspartylthreon… ycylglutamylalanylphenylalanylarginyll… ylglycylarginylprolylprolylprolylthreo… lysylaspartylglycyllysylglutamylleucyl… ucylglutamylisoleucyllysylisoleucylala… lasparaginylleucylvalylasparaginyllysy… laspartylserylglycylalanyltyrosylthreo… raginylprolylglycylglycylphenylalanyla… anylasparaginylvalyllysylvalylleucylas… ylglutamylglycylprolylleucylalanylvaly… glutamyllysylcysteinylvalylleucylseryl… eucylaspartylaspartylglycylglycylalany… sylisoleucylvalylglutaminyllysylarginy… alanyltryptophylthreonylasparaginylval… lvalylthreonyllysylleucyllysylvalylthr… paraginylglutamyltyrosylisoleucylpheny… alylasparaginyllysyltyrosylglycylvalyl… erylglutamylprolylvalylleucylalanylval… lylprolylaspartylprolylprolyllysylaspa… hreonylisoleucylthreonyllysylaspartyls… ptophylglycylhistidylprolylaspartylser… isoleucylisoleucylasparaginyltyrosylis… spartyllysylalanylglycylglutaminylargi… lasparaginyllysyllysylthreonylleucylth… ysylvalylserylglycylleucylthreonylglut… utamylphenylalanylarginylisoleucylmeth… lalanylglycylisoleucylserylalanylproly… ylalanyltyrosyllysylalanylcysteinylasp… prolylglycylprolylprolylglycylasparagi… threonylserylarginylserylserylisoleucy… raginyllysylprolylisoleucyltyrosylaspa… cylthreonylglycyltyrosylmethionylvalyl… glutamylglutamylaspartylglutamyltrypto… lprolylprolylalanylglycylleucyllysylal… leucylthreonylglycylleucylthreonylglut… rosyllysylisoleucylarginylisoleucyltyr… glutamylglycylleucylglycylglutamylprol… onylprolyllysylalanylglutamylaspartyla… utamylisoleucylglutamylleucylaspartyla… lvalylthreonylisoleucylarginylalanylcy… ylleucylphenylalanylvalylprolylisoleuc… rolylglutamylvalyllysyltryptophylalany… mylserylleucylaspartyllysylalanylseryl… ryltyrosylthreonylleucylleucylisoleucy… inylarginylphenylalanylaspartylserylgl… onylvalylglutamylasparaginylserylseryl… anylvalylasparaginylvalylarginylvalyll… olylprolylglutaminylaspartylleucyllysy… ylthreonylserylvalylthreonylleucylthre… eucylleucylaspartylglycylglycylserylly… isoleucylvalylglutamyllysylarginylglut… tyrosylserylthreonylvalylalanylthreony… hreonylseryltryptophyllysylvalylaspart… lglycylcysteinylseryltyrosyltyrosylphe… utamylasparaginylglutamyltyrosylglycyl… utamylthreonylalanylglutamylserylvalyl… ylleucylprolylprolylglycyllysylisoleuc… lylthreonylarginylasparaginylserylvaly… lysylprolylglutamylhistidylaspartylgly… lglycyltyrosylisoleucylvalylglutamylme… lserylaspartyllysyltryptophylalanylthr… sylvalylthreonylglutamylalanylthreonyl… cylglutaminylglycylglutamylglutamyltyr… rylalanylglutaminylasparaginylglutamyl… olylarginylglutaminylleucylserylvalylp… tylleucylvalylisoleucylprolylprolylala… nylalanylasparaginylthreonylphenylalan… utamylaspartylleucyllysylvalylaspartyl… cylarginylprolylthreonylprolylalanylva… spartylasparaginylvalylprolylleucyllys… valylasparaginylalanylglutamylserylthr… serylleucylleucylthreonylisoleucyllysy… amylaspartylvalylglycylhistidyltyrosyl… ginylserylalanylglycylglutamylalanylis… ginylvalylisoleucylvalylleucylaspartyl… ylglycylprolylvalyllysylmethionylaspar… tylserylisoleucylthreonylleucylseryltr… sylaspartylglycylglycylserylserylisole… oleucylvalylglutamyllysylarginylaspart… onyltryptophylglutaminylisoleucylvalyl… ylthreonylthreonylisoleucyllysylalanyl… glycylcysteinylglutamyltyrosylglutamin… lalanylglutamylasparaginylarginyltyros… ucylasparaginylserylglutamylprolylthre… lylphenylalanyllysylvalylprolylglycylp… lvalylthreonylleucylserylserylarginyla… lutaminyltryptophylasparaginylglutamyl… lycylserylarginylvalylisoleucylglycylt… lysylglutamylarginylasparaginylserylis… ucylasparaginyllysylthreonylprolylisol… henylalanyllysylthreonylthreonylglycyl… utamyltyrosylglutamylphenylalanylargin… ylisoleucylvalylglycylisoleucylglycyll… mylcysteinyltyrosylvalylalanylarginyla… lprolylglycylarginylprolylglutamylalan… ginylasparaginylserylvalylthreonylleuc… lylthreonyltyrosylaspartylglycylglycyl… rosylisoleucylvalylglutamyllysyllysylg… ginyltryptophylmethionyllysylalanylser… oleucylisoleucylaspartylthreonylhistid… glycylleucylvalylglutamylaspartylhisti… ylarginylvalylisoleucylalanylarginylas… nylalanylserylglutamylprolylserylgluta… ylthreonylalanylarginylaspartylglutamy… oleucylserylmethionylaspartylprolyllys… ucylvalylvalylhistidylalanylglycylglut… rtylalanylaspartylisoleucyltyrosylglyc… lisoleucylglutaminyltryptophylisoleucy… mylleucylserylasparaginylthreonylalany… lserylthreonylaspartylphenylalanylalan… laspartylalanylvalylarginylvalylaspart… eucylleucyllysylalanyllysylasparaginyl… ylvalylthreonylvalylasparaginylvalylly… glycylprolylprolylglutamylglycylprolyl… threonylalanylglutamyllysylcysteinylth… olylprolylleucylglutaminylaspartylglyc… ucylasparaginyltyrosylisoleucylvalylgl… lserylarginylleucylvalyltryptophylthre… inylvalylglutaminylthreonylleucylseryl… cylleucylglutamylglycylasparaginylglut… nylisoleucylmethionylalanylvalylaspara… lutamylprolylleucylglutamylserylglutam… ginylprolylphenylalanylvalylvalylproly… lylglutamylvalylthreonylthreonylvalylt… soleucylvalylvalyltryptophylglutamylar… lglycylserylglutamylisoleucylleucylgly… rginylaspartyllysylglutamylglycylisole… lcysteinylhistidyllysylarginylleucylis… eucylarginylvalylthreonylglycylleucyli… aspartyltyrosylglutamylphenylalanylarg… inylalanylalanylglycylleucylserylgluta… yltyrosylglutaminyllysylalanylcysteiny… lprolylglycylprolylprolylasparaginylas… spartylisoleucylthreonylarginylserylse… tophylseryllysylprolylisoleucyltyrosyl… ylisoleucylglutaminylglycyltyrosylisol… artylvalylasparaginylvalylglycylglutam… nylthreonylprolylprolylthreonylglycyli… araginylisoleucylglutamylvalylglutamyl… dylglutamyltyrosylasparaginylphenylala… soleucylasparaginyllysylalanylglycylva… rtylvalylprolylglycylprolylisoleucylis… ucylglutamylalanylprolylaspartylisoleu… amylleucylarginyllysylisoleucylisoleuc… glycylglycylserylleucylarginylleucylph… glycylarginylprolylthreonylprolylgluta… alylaspartylglycylglutamylisoleucylarg… oleucylaspartylvalylthreonylserylseryl… lleucylaspartylasparaginylvalylasparag… yllysyltyrosylthreonylleucylthreonylle… ycylthreonyllysylserylalanylphenylalan… cylaspartylthreonylprolylserylprolylpr… lthreonylglutamylisoleucylthreonyllysy… reonyltryptophylglutamylprolylprolylle… lysylisoleucyllysylasparaginyltyrosyli… utamylalanylthreonylarginyllysylserylt… lasparaginylcysteinylhistidyllysylaspa… laspartylglutaminylleucylglutaminylglu… osylphenylalanylarginylvalylthreonylal… sylglycylisoleucylglycylleucylprolylal… lprolylisoleucyllysylvalylalanylglutam… glycyllysylisoleucylthreonylvalylaspar… raginylserylvalylserylleucylseryltrypt… tidylaspartylglycylglycylseryllysyliso… leucylvalylglutamylmethionylglutaminyl… yltryptophylserylglutamylcysteinylalan… minylalanylvalylisoleucylthreonylaspar… lglutamylglutamyltyrosylleucylphenylal… araginylglutamyllysylglycylarginylsery… anylvalylprolylisoleucylvalylalanyllys… mylprolylaspartylvalyllysylprolylalany… valylglutaminylvalylglycylglutaminylas… alylprolylisoleucylserylglycylarginylp… reonyltryptophylthreonyllysylaspartylg… nylthreonylthreonylarginylisoleucylasp… eucylaspartylleucylthreonylthreonylleu… nylhistidyllysylaspartylaspartylglycyl… cylthreonylvalylalanylasparaginylvalyl… lanylserylisoleucylglutamylisoleucylva… laspartylprolylprolyllysylglycylprolyl… tylvalylserylalanylglutamylserylisoleu… araginylprolylprolylleucyltyrosylthreo… soleucylthreonylasparaginyltyrosylisol… artylthreonylthreonylthreonylthreonylv… ylalanylthreonylvalylalanylarginylthre… llysylleucyllysylthreonylglycylthreony… nylarginylisoleucylphenylalanylalanylg… cylglutaminylserylphenylalanylalanylle… eucylvalylalanylglutaminyltyrosylproly… olylprolylglycylthreonylprolylphenylal… ryllysylaspartylserylmethionylvalyliso… lutamylprolylvalylasparaginylasparagin… ucylglycyltyrosylhistidylleucylglutamy… inylserylisoleucylleucyltryptophylthre… nylisoleucylisoleucylhistidylaspartylt… lanylglutaminylasparaginylleucylglutam… rosylglutamylphenylalanylarginylvalylt… eucylvalylglycylvalylglycyllysylalanyl… ysteinyltyrosylvalylalanylarginylaspar… lylglycylthreonylprolylglutamylprolyli… sparaginylglutamylisoleucylthreonylleu… lprolylvalyltyrosylaspartylglycylglycy… cyltyrosylisoleucylvalylglutamyllysyla… lycylarginyltryptophylmethionyllysylal… ginylvalylisoleucylglutamylthreonylglu… ylglycylleucylthreonylglutamylaspartyl… nylalanylarginylvalylisoleucylalanylly… nylisoleucylseryllysylprolylserylaspar… ylthreonylalanyllysylaspartylglutamylv… eucylserylmethionylaspartylprolyllysyl… isoleucylvalylvalylasparaginylalanylgl… inylleucylglutamylalanylaspartylvalylh… lthreonylisoleucylglutamyltryptophylle… mylisoleucylglutamylglutamylserylalany… ysylasparaginylthreonylaspartylphenyla… ylvalyllysylaspartylalanylisoleucylarg… utaminyltyrosylisoleucylleucylarginyla… cylseryllysylserylphenylalanylprolylva… aspartylarginylprolylglycylprolylproly… lvalylthreonylglycylvalylthreonylseryl… reonyltryptophylserylprolylprolylleucy… laspartylisoleucylserylhistidyltyrosyl… mylthreonylserylarginylleucylalanyltry… lglutamylvalylvalylthreonylasparaginyl… eucylleucylglutamylglycylasparaginylgl… ylisoleucylmethionylalanylvalylasparag… utamylprolylleucylglutamylserylalanylp… aginylprolylphenylalanylvalylleucylpro… ylglutamylvalylthreonylasparaginylisol… nylthreonylvalylcysteinyltryptophylasp… spartylglycylglycylserylglutamylisoleu… alylglutamyllysylarginylaspartylarginy… hylisoleucyllysylcysteinylasparaginyll… aspartylleucylarginylleucylarginylvaly… ylaspartylhistidylglutamyltyrosylgluta… nylglutamylasparaginylalanylalanylglyc… lylalanylthreonylvalyltyrosyltyrosylly… ylphenylalanyllysylprolylglycylprolylp… dylisoleucylvalylaspartylthreonylthreo… reonylleucylalanyltryptophylglycyllysy… ylglycylserylglutamylisoleucylleucylgl… cylcysteinyllysylalanylaspartylglutamy… ylisoleucylvalylthreonylprolylglutamin… hreonylarginylphenylalanylglutamylisol… ylhistidylglutaminylglutamyltyrosyllys… nylleucylasparaginyllysylvalylglycylle… ylvalylprolylglycylthreonylvalyllysylp… tamylalanylprolylglutamylleucylasparty… rginyllysylglycylisoleucylvalylvalylar… rginylisoleucylhistidylisoleucylprolyl… lmethionylprolylglutamylisoleucylthreo… utamylglycylglutamylphenylalanylthreon… ucylglutamyllysylglycylvalylasparaginy… ylisoleucylaspartylasparaginylcysteiny… alanylglycyllysyltyrosylisoleucylleucy… lserylglycylseryllysylserylalanylpheny… leucylaspartylthreonylprolylglycylprol… alanylvalyllysylglutamylvalylarginylly… eucylvalyltryptophylglutamylprolylprol… lycylalanyllysylvalyllysylasparaginylt… ginylglutamylserylthreonylarginyllysyl… serylseryllysylcysteinylseryllysylthre… amylasparaginylleucylthreonylglutamylg… henylalanylarginylvalylmethionylalanyl… anylglycylvalylglycylvalylprolylvalylg… alyllysylalanylalanylglutamylprolylpro… lthreonylleucylthreonylaspartylvalylse… ylleucylmethionyltryptophylglutamyllys… cylglycylserylarginylvalylleucylglycyl… lutaminylprolyllysylglycylthreonylglut… lylalanylglutamylseryllysylvalylcystei… nylglycylleucylserylserylglycylglutami… lanylarginylvalyllysylalanyltyrosylasp… ylaspartylprolylarginylvalylleucylglyc… sylaspartylleucylthreonylisoleucylglut… rolylphenylalanylasparaginylthreonylty… glycylglutamylaspartylleucyllysylisole… leucylglycylarginylprolylarginylprolyl… valyllysylaspartylglycylglutamylprolyl… ylarginylvalylasparaginylvalylglutamyl… threonylvalylleucylhistidylisoleucylly… partylaspartylphenylalanylglycyllysylt… reonylasparaginylserylalanylglycylthre… ylleucylserylvalylisoleucylvalylleucyl… ylvalylglycylprolylvalylarginylphenyla… ylaspartylphenylalanylvalylvalylisoleu… lylalanyltyrosylthreonylglycylglycylcy… raginyltyrosylisoleucylvalylglutamylly… hreonylthreonylthreonyltryptophylhisti… lvalylalanylarginylthreonylthreonyliso… ucyllysylthreonylglycylthreonylglutamy… ylisoleucylphenylalanylalanylglutamyla… serylalanylprolylleucylaspartylserylly… nyltyrosylprolylphenylalanyllysylgluta… reonylprolylphenylalanylvalylthreonyls… aminylmethionylleucylvalylglutaminyltr… asparaginylaspartylglycylglycylthreony… ylhistidylleucylglutamylglutaminyllysy… ucylleucyltryptophylvalyllysylleucylas… ylglutaminylaspartylthreonyllysylpheny… eucylaspartylglutamylglycylleucylgluta… valylserylalanylglutamylasparaginyliso… ylprolylseryllysylvalylserylglutamylcy… ylaspartylprolylcysteinylaspartylproly… lanylisoleucylvalylisoleucylthreonylar… eonylleucyllysyltryptophyllysyllysylpr… ylseryllysylisoleucylthreonylglycyltyr… laspartylleucylprolylaspartylglycylarg… erylphenylalanylthreonylasparaginylval… nylalanylthreonylvalylserylglycylleucy… inyltyrosylglutamylphenylalanylarginyl… nylalanylalanylglycylasparaginylphenyl… tylserylserylglycylalanylisoleucylthre… oleucylaspartylalanylprolylasparaginyl… ltyrosyllysylaspartylvalylisoleucylval… threonylphenylalanylvalylleucylglutamy… yllysylprolylisoleucylprolylaspartylva… lglycyllysylglutamylleucylglutamylglut… ionylglutamylisoleucyllysylserylthreon… hreonylleucylvalylvalyllysylaspartylcy… rtylglycylglycylglutaminyltyrosylisole… ylvalylglycylglycylthreonyllysylseryli… llysylvalylleucylaspartylarginylprolyl… ylleucyllysylvalylthreonylglycylvalylt… tyrosylleucylalanyltryptophylasparagin… tylglycylglycylalanylasparaginylisoleu… leucylglutamyllysylarginylglutamylthre… ylthreonylglutaminylvalylserylthreonyl… asparaginyltyrosyllysylvalylthreonylly… nylglutamyltyrosylisoleucylphenylalany… paraginyllysyltyrosylglycylisoleucylgl… ylglycylprolylvalylthreonylalanylcyste… olylprolylglycylprolylprolylserylthreo… oleucylthreonyllysylaspartylserylmethi… nylarginylprolylvalylaspartylaspartylg… lglutamylglycyltyrosylisoleucylleucylg… tamylglycylvalylarginyltryptophylthreo… sylthreonylleucylthreonylaspartylleucy… lycylleucylthreonylglutamylglycylhisti… arginylvalylalanylalanylglutamylaspara… lutamylprolylserylglutamylprolylserylv… lcysteinylaspartylalanylleucyltyrosylp… sparaginylprolyllysylvalylthreonylaspa… alylserylleucylalanyltryptophylserylly… ycylglycylalanylprolylvalyllysylglycyl… glutamylalanylalanylalanylaspartylglut… inylthreonylprolylprolylthreonylglycyl… ylphenylalanylthreonylvalylthreonyllys… eonylglutamyltyrosylasparaginylphenyla… lisoleucylasparaginylserylglutamylglyc… reonylleucylprolylglycylserylvalylvaly… leucylglutamylprolylprolylglutamylisol… partylleucylarginyllysylvalylvalylvaly… onylleucylarginylleucylphenylalanylval… ylprolylglutamylprolylglutamylvalyllys… amylglycylisoleucylleucylthreonylaspar… glutamylvalylthreonylserylserylphenyla… oleucylaspartylasparaginylvalylthreony… ycylarginyltyrosylasparaginylleucylthr… aginylserylglycylseryllysylthreonylala… larginylvalylleucylaspartylserylprolyl… ucylthreonylisoleucylarginylglutamylva… onylleucylseryltryptophylglutamylproly… lglycylalanyllysylisoleucylthreonylasp… yllysylarginylglutamylthreonylthreonyl… onylisoleucylthreonylasparaginylaspara… threonylphenylalanylarginylisoleucylgl… utamylglycylcysteinylseryltyrosyltyros… nylserylasparaginylglutamyltyrosylglyc… glutamylthreonylthreonylglutamylprolyl… rolylleucylprolylprolylglycylarginylva… threonylarginylasparaginylthreonylalan… lutamyllysylprolylglutamylserylasparty… eonylglycyltyrosylvalylvalylglutamylme… lserylglutamyllysyltryptophylserylthre… llysylthreonylleucylglutamylalanylthre… nylalanylglycylglutamylglutamyltyrosyl… alanylvalylasparaginylglutamyllysylgly… lglutaminylleucylglycylvalylprolylvaly… eucylglutamylisoleucyllysylprolylseryl… ylhistidylthreonylphenylalanylasparagi… lutaminylleucyllysylisoleucylaspartylv… ginylprolylglutaminylalanylthreonylval… aspartylglycylglutaminylthreonylleucyl… lvalylasparaginylvalylserylserylseryll… lserylisoleucyllysylglutamylalanylsery… reonyltyrosylglutamylleucylcysteinylva… lserylisoleucylthreonylvalylprolylisol… lleucylaspartylarginylprolylglycylprol… lisoleucylaspartylglutamylvalylserylcy… ylisoleucylseryltryptophylasparaginylp… lycylglycylcysteinylglutaminylisoleucy… lylglutamyllysyllysylglutamylthreonylt… hylhistidylisoleucylvalylserylglutamin… erylisoleucyllysylisoleucylvalylarginy… lutamyltyrosylglutaminylphenylalanylar… paraginylarginyltyrosylglycyllysylsery… lalanylvalylvalylalanylglutamyltyrosyl… glycylprolylprolylglycylthreonylprolyl… yllysylserylthreonylmethionylleucylval… prolylvalylasparaginylaspartylglycylgl… ltyrosylhistidylleucylglutamyltyrosyll… cylleucyltryptophylseryllysylalanylasp… ylalanylaspartylthreonylglutaminylvaly… lglutamylglycylleucylmethionyltyrosylg… anylglutamylasparaginylisoleucylalanyl… seryllysylserylcysteinylglutamylprolyl… lylcysteinylaspartylprolylprolylglycyl… ylasparaginylisoleucylthreonylarginyll… ophylseryllysylprolylhistidyltyrosylas… cylthreonylglycyltyrosylisoleucylvalyl… lprolylaspartylglycylarginyltryptophyl… sylthreonylasparaginylisoleucylglutami… nylglutamylvalylthreonylglutamylleucyl… rginyltyrosylglutamylphenylalanylargin… araginylalanylalanylaspartylserylvalyl… ylthreonylglycylprolylisoleucylisoleuc… utamylprolylprolylarginylvalylmethiony… lanylarginylaspartylvalylisoleucylvaly… lleucyllysylisoleucylasparaginylalanyl… lprolylleucylprolylvalylisoleucylseryl… isoleucylglutamylisoleucylglutamylglut… tamylisoleucylisoleucylserylthreonylas… ucylleucylthreonylvalyllysylaspartylcy… tylthreonylglycylglutaminyltyrosylvaly… ylvalylalanylglycylthreonylarginylsery… yllysylvalylleucylaspartyllysylprolylg… leucylglutamylisoleucylasparaginylglyc… cysteinylserylleucylseryltryptophylgly… spartylglycylglycylalanylaspartylisole… rginyllysyllysylarginylglutamylthreony… lthreonylisoleucylcysteinylglutamylgly… lthreonylserylcysteinyllysylvalylthreo… raginylglutamyltyrosylisoleucylphenyla… lasparaginyllysyltyrosylglycylvalylgly… lvalylalanylisoleucyllysylalanylleucyl… alylprolylserylprolylprolylthreonylser… rylvalylthreonyllysylglutamylserylmeth… hylserylarginylprolylglutamylserylaspa… cylserylglycyltyrosylisoleucylisoleucy… lasparaginylserylleucylarginyltryptoph… lysylprolylvalyltyrosylaspartylleucyla… leucylarginylglutamylglycylcysteinylgl… valyltyrosylalanylglutamylasparaginyla… rolylserylglutamylthreonylserylprolyll… aspartylprolylvalylphenylalanylleucylp… lyllysylisoleucylvalylaspartylserylgly… reonylisoleucylalanyltryptophylvalylly… glycylglycylalanylprolylisoleucylthreo… yltyrosyllysyllysylserylaspartylaspart… reonylserylisoleucylglutaminylserylleu… osylthreonylisoleucylserylglycylleucyl… ltyrosylvalylphenylalanylarginylvalyll… glycylalanylserylaspartylprolylserylas… minylisoleucylalanyllysylglutamylargin… cylphenylalanylaspartylisoleucylaspart… lthreonylleucylisoleucylvalyllysylalan… onylmethionylthreonylvalylprolylphenyl… ylprolylasparaginylvalylleucyltryptoph… spartylleucylarginylthreonylarginylala… onylaspartylserylarginylthreonylseryll… aginylalanylasparaginylarginylasparagi… hreonylleucylthreonylisoleucylglutamin… alanylserylleucylthreonylleucylvalylva… prolylglycylprolylprolylthreonylaspara… ylaspartylvalylthreonyllysylglutamylse… aspartylvalylprolylglutamylasparaginyl… yllysylasparaginyltyrosylhistidylisole… nylseryllysyllysylalanyltryptophylvaly… aginylcysteinylasparaginylarginylleucy… raginylleucylglutaminylglutamylglycyla… lanylarginylvalylserylglycylglutamylas… valylglycylisoleucylprolylalanylglutam… ysylisoleucylthreonylglutamyllysylprol… cylglycylvalylthreonylserylisoleucylse… ylthreonyltryptophylleucyllysylprolylg… serylarginylisoleucylvalylhistidyltyro… utamyllysylglycylglutaminyllysylaspara… lanylvalylalanyllysylserylthreonylhist… ucylarginylglutamylasparaginylserylglu… larginylvalylphenylalanylalanylglutamy… eucylserylaspartylprolylarginylglutamy… lisoleucyllysylglutamylglutaminylleucy… cylaspartylmethionyllysylasparaginylph… ylvalyltyrosylvalylarginylalanylglycyl… artylisoleucylprolylisoleucylserylglyc… threonylleucylserylarginylaspartylglyc… nylmethionylarginylphenylalanylasparag… ylalanylglutamylasparaginylleucylthreo… lutamylserylvalylthreonylalanylasparty… isoleucylthreonylalanylalanylasparagin… ysylalanylphenylalanylisoleucylasparag… ylarginylprolylglycylprolylprolylthreo… erylaspartylisoleucylthreonylglutamylg… ltryptophylglutamylprolylprolyllysylty… minylvalylthreonylasparaginyltyrosylis… amylthreonylserylthreonylalanylvalyltr… lanylthreonylvalylalanylarginylthreony… nyllysylleucylthreonylthreonylglycylgl… ylalanylarginylisoleucyllysylalanylglu… glycylisoleucylserylaspartylhistidylis… valylthreonylvalyllysylleucylprolyltyr… lylprolylserylthreonylprolyltryptophyl… ylarginylglutamylserylisoleucylthreony… mylprolylvalylserylasparaginylglycylgl… sylhistidylleucylglutamylmethionyllysy… leucylleucyltryptophylglutaminyllysyla… leucylarginylthreonylthreonylhistidylp… ylisoleucylserylalanylglycylleucylisol… inylvalyltyrosylalanylglutamylasparagi… ylprolylserylhistidylprolylserylglutam… spartylalanylcysteinylglutamylprolylpr… soleucylthreonylaspartylisoleucylseryl… ylseryltryptophylglutaminylglutaminylp… ylglycylseryllysylisoleucylthreonylgly… inylarginylaspartylleucylprolylasparty… ylalanylserylphenylalanylthreonylaspar… glutaminylphenylalanylthreonylisoleucy… lasparaginylserylglutaminyltyrosylglut… lanylalanylarginylasparaginylalanylval… nylprolylserylglutamylvalylvalylglycyl… leucylaspartylseryltyrosylglycylglycyl… rolylleucylglutamyltyrosylthreonylglut… anylglycylthreonylserylvalyllysylleucy… lycyllysylprolylalanylprolylthreonylis… ylaspartylaspartyllysylglutamylleucylg… eucylvalylcysteinylvalylglutamylaspara… alanylserylisoleucylleucylisoleucyllys… ylasparaginylserylglycylcysteinyltyros… sparaginylalanylmethionylalanylserylal… inylvalylglutaminylisoleucylleucylaspa… ycylglycylprolylisoleucylglutamylpheny… anylglutamyllysylisoleucylthreonylleuc… ylalanylaspartylaspartylglycylglycylal… yrosylisoleucylvalylglutamyllysylargin… valyltryptophylserylmethionylvalylsery… amylcysteinylisoleucylisoleucylthreony… eucyllysylglycylasparaginylglutamyltyr… ylarginylalanylvalylasparaginyllysylty… rolylleucylglutamylserylaspartylserylv… ylphenylalanylvalylthreonylprolylglycy… lutamylvalylthreonyllysylisoleucylthre… hreonylvalylvalyltryptophylserylarginy… lglycylserylaspartylisoleucylserylglyc… lysylarginylaspartyllysyllysylserylleu… lvalylleucyllysylglutamylthreonylisole… lutaminyllysylvalylthreonylglycylleucy… partyltyrosylglutaminyltyrosylarginylv… alanylalanylglycylglutaminylglycylprol… rylglutamylphenylalanyltyrosyllysylala… artylprolylprolylglycylprolylprolylala… anylaspartylserylthreonyllysylserylser… tophylseryllysylprolylvalyltyrosylaspa… eonylglycyltyrosylvalylvalylglutamylis… mylglutamylglutamylglutamyltryptophylt… sylglycylglutamylvalylarginylthreonylt… ylasparaginylleucyllysylprolylglycylva… lanylarginylvalylserylalanylvalylaspar… ylglycylglutamylprolylisoleucylglutamy… valylglutaminylalanyllysylaspartylisol… amylisoleucylaspartylleucylaspartylval… alylisoleucylalanyllysylalanylglycylgl… eucylisoleucylprolylphenylalanyllysylg… nylvalylthreonyltryptophylarginyllysyl… cylglycylserylaspartylalanylarginyltyr… ylthreonylaspartylserylserylserylleucy… minylvalylthreonylarginylasparaginylas… leucylleucylthreonylisoleucylglutamyla… prolyllysylserylserylthreonylvalylsery… nylprolylalanylalanylcysteinylglutamin… stidylvalylserylarginylglycylthreonylv… spartylprolylprolylleucylisoleucylaspa… lisoleucylasparaginyltyrosylvalylisole… nylthreonyllysylarginylthreonyltryptop… lcysteinylserylserylthreonylserylpheny… leucylserylglutamyllysylthreonylprolyl… larginylvalylleucylalanylglutamylaspar… cylglycylglutamylprolylcysteinylglutam… yllysylalanylalanylglutamylvalylprolyl… lleucylserylmethionyllysylaspartylsery… leucylleucylseryltryptophylthreonyllys… lglycylglycylserylvalylisoleucylthreon… arginyllysylglycyllysylglycylglutamylg… tidylalanylglycylisoleucylseryllysylth… tamylvalylserylglutaminylleucyllysylgl… tamylphenylalanylarginylvalylphenylala… sylglycylleucylserylaspartylprolylvaly… ucylthreonylvalyllysylglutamylleucylis… mylvalylaspartylleucylserylaspartyliso… alylthreonylvalylarginylisoleucylglycy… ucylglutamylleucylprolyltyrosyllysylgl… eucylseryltryptophylleucyllysylasparty… mylserylglutamylphenylalanylvalylargin… tamylasparaginyllysylisoleucylthreonyl… lalanyllysyllysylglutamylhistidylglycy… leucylleucylaspartylasparaginylalanylv… valylprolylisoleucylthreonylvalylisole… lseryllysylprolyllysylglycylprolylisol… tamylisoleucyllysylalanylaspartylseryl… aspartylvalylprolylglutamylaspartylasp… soleucylthreonylcysteinyltyrosylseryli… lthreonylserylglutaminylthreonylaspara… ysteinylserylserylvalylalanylarginylth… lprolylasparaginylleucylvalyllysylaspa… phenylalanylarginylvalylarginylalanylg… cylvalylserylglutaminylprolylleucylval… alanyllysylhistidylglutaminylphenylala… ylprolylglycyllysylprolylvalylisoleucy… ylaspartylglycylmethionylserylleucylth… lvalyltyrosylaspartylglycylglycylseryl… anylhistidylvalylglutamyllysyllysylglu… ylleucyltryptophylglutaminyllysylvalyl… ucylserylglycylarginylglutamyltyrosyla… ylglutamylglycylleucylaspartyltyrosylg… rosylalanylglutamylasparaginylserylala… laspartylprolylseryllysylphenylalanylt… valylaspartylprolylprolylglycylthreony… rtylvalylthreonylarginylglutamylthreon… ophylasparaginylprolylprolylleucylargi… oleucylvalylglycyltyrosylserylisoleucy… ylasparaginylglutamylarginyltryptophyl… nylalanylthreonylaspartylvalylserylglu… onylvalylthreonylglycylleucylserylprol… mylphenylalanylarginylisoleucylisoleuc… ylglycylthreonylisoleucylserylprolylpr… isoleucylisoleucylmethionylthreonylarg… lprolylprolylisoleucylvalylglutamylphe… lphenylalanylaspartylglycylleucylisole… ylserylleucylarginylisoleucyllysylalan… lprolylvalylprolylarginylvalylthreonyl… glycylvalylglutamylisoleucylglutamylly… onylglutamylisoleucylthreonylasparagin… ylleucylphenylalanylvalylarginylaspart… idylarginylglycylvalyltyrosylthreonylv… lanylserylglycylserylalanyllysylalanyl… ylglutaminylaspartylthreonylprolylglyc… cylarginylphenylalanylthreonylasparagi… ysylmethionylthreonylleucyltryptophylt… asparaginylaspartylglycylcysteinylalan… rosylisoleucylisoleucylglutamyllysylar… ucylalanyltryptophylalanylleucylisoleu… utamylalanylglutaminylseryltyrosylthre… ucylasparaginylglycylasparaginylglutam… nylvalylserylalanylvalylasparaginyllys… nylprolylleucylaspartylserylaspartylpr… ucylglutaminyltyrosylthreonylvalylprol… ylprolylglutamylprolylserylasparaginyl… erylisoleucylthreonylleucylthreonyltry… erylaspartylglycylglycylserylglutamyli… isoleucylleucylglutamylarginylarginylg… yltryptophylvalyllysylvalylisoleucylse… glutamylthreonylarginylphenylalanyllys… glutamylglycylasparaginylglutamyltyros… methionylalanylglutamylasparaginylalan… ylserylglycylisoleucylserylarginylleuc… tamylprolylvalylasparaginylprolylproly… yllysylvalylthreonylaspartylthreonylse… eucylglutamyltryptophylseryllysylproly… cylmethionylglutamylisoleucylisoleucyl… amylmethionylcysteinyllysylthreonylasp… histidyllysylvalylasparaginylalanylglu… nylarginyltyrosylthreonylvalylthreonyl… lglutamylglutamyltyrosyllysylphenylala… asparaginylglycylalanylglycyllysylglyc… ylthreonylglycylthreonylisoleucyllysyl… eonylalanylprolylglutamylleucylasparty… phenylalanyllysylglutaminylthreonylhis… lanylserylisoleucylarginylleucylphenyl… nylglycylarginylprolylthreonylprolylth… ylprolylaspartylserylasparaginylleucyl… leucylhistidylthreonylthreonylaspartyl… lthreonylvalylglutamylasparaginylcyste… partylalanylglycyllysyltyrosylthreonyl… nylasparaginylserylglycylseryllysylser… onylvalyllysylvalylleucylaspartylthreo… olylisoleucylthreonylphenylalanyllysyl… erylalanylthreonylleucylmethionyltrypt… ylaspartylglycylglycylalanylarginyliso… alylglutamyllysylarginylglutamylalanyl… lutaminylvalylisoleucylserylglutamylly… ylisoleucylphenylalanyllysylvalylaspar… lycylvalylprolyltyrosyltyrosylphenylal… araginylglutamyltyrosylglycylvalylglyc… ionylprolylglutamylprolylisoleucylvaly… olylalanylprolylprolylarginylarginylle… nylseryllysylserylserylalanylvalylleuc… aspartylhistidylaspartylglycylglycylse… rosylleucylleucylglutamylmethionylargi… ylleucyltryptophylvalylglutamylalanylg… lleucylthreonylphenylalanylthreonylval… llysylthreonylglutamyltyrosylglutamylp… ysylasparaginylaspartylalanylglycyltyr… mylalanylphenylalanylserylserylvalylis… glutaminylisoleucylglutamylprolylthreo… ylisoleucylthreonylasparaginylglutamin… ysylalanylglycylserylprolylphenylalany… ylisoleucylserylglycylarginylprolylala… yllysylleucylglutamylglutamylmethionyl… spartylarginylvalylserylisoleucylthreo… inylthreonylthreonylleucylthreonylvaly… glycylaspartylserylglycylarginyltyrosy… utamylasparaginylthreonylalanylglycylv… alylthreonylvalylvalylvalylisoleucylgl… hreonylglycylprolylisoleucylglutamylva… ylserylcysteinylvalylleucylseryltrypto… ylglycylglycylglycylthreonylglutamylis… oleucylvalylglutamyllysylarginylglutam… tryptophylglutaminylleucylvalylasparag… onylglutaminylisoleucyllysylvalylthreo… ylmethionylglutamyltyrosylserylphenyla… asparaginylarginylphenylalanylglycylva… rylalanylprolylisoleucylisoleucylalany… valylprolylprolylserylalanylprolylthre… ylhistidylvalylserylalanylasparaginyla… tryptophylglutamylglutamylprolyltyrosy… ysylisoleucylisoleucylglycyltyrosyltry… mylarginylasparaginylthreonylisoleucyl… sparaginyllysylvalylprolylcysteinylleu… syllysylvalylthreonylglycylleucylvalyl… glutaminylphenylalanylarginylthreonylt… alanylglycylvalylseryllysylalanylseryl… leucylmethionylalanylglutaminylasparag… glycylarginylprolylglutamylvalylthreon… threonylvalylserylleucylisoleucyltrypt… aspartylglycylglycylseryllysylvalylval… utamylarginyllysylprolylvalylserylglut… ltryptophylleucyllysylcysteinylasparag… rylaspartylasparaginylphenylalanylphen… leucylserylglutamylglycylaspartylthreo… ylvalylleucylalanyllysylasparaginylala… ysylglycylserylglutamylserylthreonylgl… inylaspartylglutamyltyrosylalanylproly… artylalanylarginylleucylhistidylglycyl… larginylalanylglycylserylaspartylleucy… ylglycylglycyllysylprolylglutamylproly… hreonyllysylglycylaspartyllysylglutamy… myllysylvalylserylleucylglutaminyltyro… threonylalanylvalylisoleucyllysylpheny… laspartylserylglycyllysyltyrosylthreon… ylalanylserylglycylthreonyllysylalanyl… alylleucylaspartylserylprolylglycylpro… ylvalylserylarginylvalylthreonylglutam… eucylalanyltryptophylserylleucylprolyl… cylalanylglutamylisoleucylthreonylhist… ginylarginylglutamylthreonylserylargin… soleucylvalylglutamylglycylglutamylcys… sylvalylvalylthreonylarginylleucylisol… tamyltyrosylisoleucylphenylalanylargin… llysyltyrosylglycylprolylglycylvalylpr… lisoleucylvalylalanylarginylasparaginy… prolylserylprolylprolylglycylisoleucyl… reonylglycyllysylglutamylhistidylisole… ptophylthreonyllysylprolylglutamylsery… tamylisoleucylserylasparaginyltyrosyll… myllysylglutamylserylleucylarginyltryp… yllysylaspartyltyrosylvalylvalyltyrosy… valylthreonylserylleucylmethionylgluta… utaminylphenylalanylarginylvalylthreon… lglycylasparaginylserylglutamylprolyls… phenylalanylisoleucylserylcysteinylarg… nylprolylglycylprolylprolylserylalanyl… onylthreonyllysylhistidylserylisoleucy… llysylprolylmethionyltyrosylaspartylgl… valylglycyltyrosylvalylleucylglutamylm… rtylthreonylaspartylglutaminyltryptoph… ylasparaginylalanylthreonylisoleucylar… nylalanylthreonylvalylprolylaspartylle… ysyltyrosylserylphenylalanylarginylval… lysylglycylmethionylserylglutamyltyros… glutamylisoleucylglutamylprolylvalylgl… ucylprolylaspartylleucylglutamylleucyl… sylthreonylvalylthreonylisoleucylargin… nylleucylmethionylvalylserylvalylseryl… lisoleucylthreonyltryptophylseryllysyl… ucylalanylserylarginylalanylisoleucyli… tamylseryltyrosylserylleucylleucylisol… inylarginyltyrosylaspartylalanylglycyl… ylalanylglutamylasparaginylglutaminyls… onylvalylleucylvalyllysylvalyltyrosyla… steinylprolylserylvalyllysylvalyllysyl… rylvalylthreonylisoleucylthreonyltrypt… lisoleucylaspartylglycylglycylalanylpr… tyrosylisoleucylvalylglutamyllysylargi… inylalanylphenylalanyllysylthreonylval… yllysylthreonylleucyltyrosylarginyliso… lglycylthreonylmethionylhistidyltyrosy… ylglutamylasparaginylisoleucyltyrosylg… ysteinylglutamylthreonylserylaspartyla… alylprolylleucylvalylprolylalanyllysyl… ylthreonyllysylserylthreonylvalylthreo… sylprolylleucyltyrosylaspartylglycylgl… ltyrosylvalylleucylglutamylalanylcyste… ylarginyltryptophylmethionyllysylvalyl… nylvalylleucylglutamylhistidylthreonyl… glutamylglycylglutamylglutaminyltyrosy… arginylalanylglutaminylasparaginylglut… olylarginylglutamylthreonylvalylthreon… laspartylleucylarginylvalylleucylproly… ylthreonylmethionylprolylglutaminyllys… lylalanylglycylarginylprolylvalylgluta… cylalanylglycylarginylprolylprolylprol… alanylphenylalanylalanylglycylseryllys… larginylvalylthreonylvalylglutamylthre… llysylleucylthreonylisoleucylarginylgl… nylaspartylthreonylglycylglutamyltyros… asparaginylvalylthreonylglycylthreonyl… cyllysylvalylisoleucylisoleucylleucyla… lthreonylglycylprolylisoleucyllysyliso… rtylalanylthreonylserylisoleucylthreon… rolylprolylglutamylleucylaspartylglycy… ltyrosylvalylvalylglutamylglutaminylar… rolylglycyltryptophylleucylprolylvalyl… nylserylthreonylphenylalanyllysylpheny… lglutamylglycylasparaginylglutamyltyro… nylalanylthreonylasparaginylarginylphe… tyrosylleucylglutaminylserylglutamylva… lserylserylisoleucylarginylisoleucylpr… nylleucylglutaminylisoleucylphenylalan… glycylmethionylthreonylleucylthreonylt… laspartylaspartylglycylglycylserylglut… leucylvalylglutamylarginyllysylglutamy… ryptophylvalylarginylvalylasparaginyll… ylthreonylarginyltyrosylarginylserylth… lycylleucylglutamyltyrosylglutamylhist… ucylasparaginylalanylarginylglycylsery… lseryllysylprolylisoleucylvalylalanylm… ylprolylprolylglycyllysylprolylglutami… eonylaspartylthreonylthreonylarginylth… yptophylserylvalylprolylglutamylaspart… ylthreonylglycyltyrosylleucylisoleucyl… ylaspartylglutaminylhistidylglutamyltr… aginylthreonylthreonylprolylthreonylly… hreonylleucylthreonylhistidylleucylpro… rosylarginylphenylalanylarginylvalylle… lglycylglycylprolylglycylglutamylproly… eonylvalyllysylvalylthreonylglutamylme… spartyltyrosylglutamylleucylaspartylgl… mylglycylisoleucylphenylalanylvalylarg… eucylarginylleucylthreonylisoleucylpro… henylalanylprolylisoleucylcysteinyllys… ycylglutaminylaspartylisoleucylserylly… lanylthreonylserylglutamylthreonylhist… eucyllysylglutamylalanylaspartylarginy… yrosylaspartylleucylvalylleucylglutamy… yllysylalanylvalyltyrosylisoleucyllysy… rylprolylasparaginylserylprolylglutamy… spartylaspartylisoleucylglutaminylvaly… tryptophylarginylprolylprolylalanylasp… rtylisoleucylleucylglycyltyrosylisoleu… amylvalylprolyllysylalanylalanyltrypto… lserylarginylvalylarginylglycylthreony… ucyllysylglutamylasparaginylvalylgluta… ylvalylserylalanylglutamylasparaginylg… lseryllysylprolylleucyllysylserylgluta… llysylthreonylprolylleucylasparaginylp… lasparaginylprolylprolylglutamylvalyll… lserylvalylserylleucylseryltryptophyls… tylglycylglycylserylarginylvalylthreon… amylarginyllysylglutamylthreonylserylt… ylhistidylasparaginyllysylthreonylglut… onylmethionyltyrosylthreonylvalylthreo… lanylglutamyltyrosylglutaminylphenylal… glutaminylasparaginylaspartylvalylglyc… rolylalanylserylglutamylprolylvalylval… lalanylaspartyllysylprolylserylglutami… ylisoleucylleucylserylisoleucylserylly… glutaminyltryptophylglutamyllysylproly… cyllysylglutamylisoleucylleucylglycylt… larginylglutaminylserylglycylaspartyls… asparaginyllysylglutamylarginylisoleuc… lalanylthreonylisoleucylglycylglycylle… tamyltyrosylglutamylphenylalanylarginy… araginylglutamylthreonylglycylleucylse… nylalanylmethionylserylisoleucyllysylt… ylglutamylalanylprolylglycylisoleucyla… partylvalylthreonylthreonyllysylleucyl… lleucylserylcysteinylglutaminylisoleuc… lylaspartylisoleucyllysyltryptophyltyr… lutamylleucylisoleucylglutaminylseryla… ylserylaspartylglycylarginylthreonylhi… thionylthreonylglutamylglutamylglutami… lyltyrosylthreonylcysteinylisoleucylal… lglycylglutamylvalylglutamylthreonylse… aminylalanylthreonylprolylglutaminylph… ylprolylleucyllysylglutamyllysyltyrosy… lthreonylleucylarginylleucylhistidylva… rginylprolylvalylprolylalanylmethionyl… dylglycylglutaminyllysylleucylleucylgl… araginylisoleucylthreonylisoleucylglut… idyltyrosylthreonylhistidylleucylvalyl… minylarginyllysylthreonylhistidylalany… inylleucylserylasparaginylvalylphenyla… nylisoleucylleucylaspartylvalylglutamy… olylaspartyllysylprolylthreonylglycylp… lalanylleucylleucyllysylasparaginylser… yllysylprolylprolylalanylaspartylaspar… ucylthreonylasparaginyltyrosylvalylval… nyllysylglutamylglycylalanylglutamyltr… erylalanylisoleucylserylvalylthreonylt… ylasparaginylleucylthreonylglutamylasp… henylalanylarginylvalylserylalanylglut… ylglycylisoleucylserylaspartylprolylle… ylisoleucylisoleucyllysylserylprolylph… alanylprolylglycyllysylprolylthreonyli… lysylaspartylserylcysteinylvalylvalyla… nylserylaspartylglycylglycylalanyllysy… tyrosylleucylglutamyllysylarginylgluta… ysyltryptophylisoleucylserylvalylthreo… larginylglutamylthreonylvalylphenylala… isoleucylglutamylglycylleucylglutamylt… lyllysylcysteinylglutamylasparaginylle… yltryptophylserylglutamylisoleucylsery… lyllysylserylaspartylvalylprolylisoleu… enylalanyllysylglutamylglutamylleucyla… alylarginyltyrosylglutaminylserylaspar… einyllysylvalylthreonylglycylhistidylp… tryptophyltyrosylarginylglutaminylglyc… anylaspartylglycylleucyllysyltyrosylar… nylalanyllysylglycylglycyltyrosylhisti… ylalanylserylvalylthreonylaspartylaspa… sylglutaminylvalylarginylalanylthreony… erylvalylserylglycylthreonylalanylsery… olylalanyllysylisoleucylhistidylleucyl… ycylmethionylglycylalanylvalylhistidyl… lylvalylserylisoleucyllysylisoleucylpr… lylaspartylprolylvalylisoleucylthreony… taminylaspartylleucylisoleucylaspartyl… ltyrosylglutaminylvalylisoleucylvalylt… onylserylleucylvalylphenylalanylprolyl… yllysylaspartylalanylglycylphenylalany… sylasparaginylarginylphenylalanylglycy… reonylvalylglutamylleucylaspartylvalyl… olylprolylarginylglycylvalyllysylvalyl… rtylserylvalylasparaginylleucylthreony… anylserylaspartylglycylglycylseryllysy… lisoleucylvalylglutamyllysylcysteinyla… arginyltryptophylleucylarginylvalylgly… hreonylarginyltyrosylthreonylvalylisol… lycyllysylthreonylseryltyrosylglutamin… alanylglutamylasparaginyllysylphenylal… ylglutamylprolylserylglutamylprolylthr… aspartyllysylthreonylarginylalanylmeth… amylglutamylvalylaspartylglutamylthreo… ylthreonyllysylalanylserylhistidylsery… rosylglutamyllysyltyrosylmethionylisol… ycylarginylglycylglutamylphenylalanylg… ysteinylvalylglutamylthreonylserylsery… alanyllysylphenylalanylvalyllysylvalyl… ylvalylleucylvalyllysyllysylglutamylis… nylisoleucylalanylarginylhistidylargin… lleucylhistidylglutamylserylphenylalan… tamylleucylvalylmethionylisoleucylphen… ylserylglycylleucylaspartylisoleucylph… sparaginylthreonylserylalanylphenylala… larginylglutamylisoleucylvalylseryltyr… teinylglutamylalanylleucylglutaminylph… ylasparaginylisoleucylglycylhistidylph… rolylglutamylasparaginylisoleucylisole… larginylserylserylthreonylisoleucyllys… lanylglycylglutaminylalanylarginylglut… ylasparaginylphenylalanylarginylleucyl… lylglutamyltyrosyltyrosylalanylprolylg… dylaspartylvalylvalylserylthreonylalan… ylserylleucylglycylthreonylleucylvalyl… isoleucylasparaginylprolylphenylalanyl… inylglutaminylglutaminylisoleucylisole… hionylasparaginylalanylglutamyltyrosyl… lglutamylalanylphenylalanyllysylglutam… anylmethionylaspartylphenylalanylvalyl… ylglutamylarginyllysylserylarginylmeth… nylleucylglutaminylhistidylprolyltrypt… eucylglutamylarginylvalylserylthreonyl… eucyllysylhistidylarginylarginyltyrosy… ucyllysyllysylaspartylleucylasparaginy… ylarginylisoleucylserylcysteinylglycyl… utaminyllysylglycylvalylserylvalylalan… oleucylglutamylisoleucylglycylprolylva… thionylhistidylalanylvalylglycylglutam… lysyltyrosylvalylcysteinyllysylisoleuc… lglutaminylserylthreonylglutaminylvaly… nylglycylvalylarginylglutaminylleucylg… ltyrosylglutamylisoleucylthreonyltyros… isoleucylleucyltyrosylvalyllysylaspart… tylaspartylglycylthreonyltyrosylarginy… laspartyltyrosylglycylglutamylaspartyl… ylphenylalanylvalyllysylglycylvalylarg… osyltyrosylcysteinylarginylarginylthre… ylarginylarginylthreonylaspartylthreon… mylarginylprolylprolylglutamylphenylal… ylasparaginyllysylthreonylalanyltyrosy… larginylphenylalanylglycylvalylthreony… ylglutamylprolylhistidylvalylthreonylt… taminyllysylisoleucyllysylprolylglycyl… yltyrosylthreonylphenylalanylglutamyls… lglutaminylleucylthreonylisoleucylaspa… partylaspartylaspartylalanylglutamylty… lasparaginyllysyltyrosylglycylglutamyl… sylleucylthreonylvalylthreonylleucylhi… artylserylthreonylleucylarginylprolylm… cylleucylalanylasparaginylalanylglutam… glutaminylserylvalylcysteinylphenylala… ylglycylisoleucylprolylprolylprolylthr… ysylaspartylglycylglutaminylprolylleuc… lisoleucylglutamylisoleucylisoleucylhi… yrosyltyrosylalanylleucylhistidylisole… olylglutamylaspartylthreonylglycyltyro… lthreonylasparaginylthreonylalanylglyc… inylalanylhistidylleucylglutaminylvaly… llysyllysylglutaminylglutamylphenylala… istidylglutamylarginylhistidylvalylglu… rtyllysylthreonylleucylarginylmethiony… glycylthreonylglutamylserylvalylprolyl… lysylglutamylalanylleucylarginylglutam… ylprolylalanylvalylserylthreonyllysylt… ylalanylarginylleucylglutamylisoleucyl… lutamylarginyllysylleucylarginylmethio… glutamylprolylarginyllysyltyrosyllysyl… glutamylglutamylaspartylglutaminylargi… anylvalylprolylmethionylserylaspartylm… lysylisoleucylarginylaspartylglutaminy… yllysylleucylaspartylarginylvalylvalyl… ginylisoleucylarginylleucylserylarginy… alanyltyrosylvalylmethionylprolylleucy… rtylglutaminyltyrosylarginylprolyllysy… sylleucylserylglutaminylaspartylaspart… ylprolylalanylarginylarginylarginylthr… ylaspartylphenylalanyltyrosyltyrosylar… ylleucylglycylaspartylisoleucylserylas… eucylprolylisoleucylaspartylaspartylty… nylthreonylglutamylglutamylglutamylarg… amylglutamylleucylglutamylleucylglycyl… rolylserylarginylserylprolylprolylhist… serylleucylarginyltyrosylserylserylpro… ylvalylglutamylglutamylthreonylarginyl… tyrosylserylthreonyltyrosylhistidyliso… amylalanylserylthreonylseryltyrosylala… inylhistidylalanylglutaminylalanylalan… ylglutaminylarginylglutaminylarginylis… ylglutamylaspartylglutamylglutamylleuc… hreonylthreonylglutaminylhistidylleucy… amylleucylaspartylphenylalanylmethiony… ylarginyllysyllysylserylarginylarginyl… nylglutamylisoleucylthreonylglutamylis… sylglutamylisoleucylseryllysylhistidyl… lserylserylserylalanylserylarginylleuc… lserylleucylserylprolylthreonyltyrosyl… inylprolylvalylserylglutamylleucylisol… minylprolylalanylglutamylglutamyltyros… lutamylarginylarginylserylprolylthreon… nylprolylarginylserylprolylserylprolyl… leucylserylarginylphenylalanylglutamyl… ylaspartylisoleucylphenylalanylserylar… ysylalanylalanylleucyllysylthreonylglu… ginyllysyltyrosylglutamylvalylleucylse… alanylthreonylleucylaspartylhistidylal… eucylarginylmethionylarginylserylhisti… lglutaminylasparaginylthreonylarginylp… ylvalylglutaminylseryllysylprolylthreo… yltyrosylhistidylasparaginylglycylvaly… rylseryllysylisoleucylhistidyltyrosylt… ylvalylleucylthreonylleucylglutamyliso… ylthreonylaspartylaspartylserylglycylt… teinylthreonylasparaginyltyrosyllysylg… osylalanylthreonylleucylaspartylvalylt… hreonylthreonyltyrosylalanylserylgluta… glutamylvalylprolylarginylserylvalylph… nylarginylthreonylglutamylalanyltyrosy… lysyllysylthreonylserylglutamylmethion… larginylglutamylvalyllysylserylglutami… larginylglutamylserylleucylserylserylt… rylalanylglutamylmethionyllysylserylal… ylserylleucylglutamylglutamyllysylsery… cyllysylthreonylthreonylleucylalanylal… ysylprolylarginylserylmethionylthreony… serylalanylarginylphenylalanylserylcys… lglutamylprolylvalylprolylthreonylvaly… ylglycylglutaminylvalylleucylserylthre… minylvalylthreonylthreonylthreonyllysy… nylglutamylisoleucylserylserylvalylglu… lycylasparaginyltyrosylserylvalylvalyl… ylglycyllysylglutaminylglutamylalanylg… reonylisoleucylglutaminyllysylalanylar… ylvalylthreonylserylprolylprolylarginy… larginylvalyllysylserylprolylglutamyla… nylvalyllysylserylprolylglutamylprolyl… serylprolylthreonylglutamylthreonyllys… yllysylvalylglutaminylhistidylleucylpr… ylisoleucylthreonylglutaminylphenylala… eryllysylglutamylisoleucylalanyllysyll… tamylserylserylvalylleucylarginylalany… yltyrosyllysylaspartylglycyllysyllysyl… lhistidylphenylalanylglutaminylphenyla… rtylglycylthreonyltyrosylglutamylleucy… ylleucylthreonylglutamylserylaspartylg… cysteinylglutamylisoleucylserylglycylg… ylthreonylasparaginylleucylglutaminylp… lalanylphenylalanyllysylserylisoleucyl… lisoleucylserylglutamylthreonyllysylly… onylthreonylglutamylserylthreonylvalyl… lprolyllysylalanylprolylglutamylprolyl… isoleucylvalylthreonylglycylleucylglut… serylserylaspartylserylvalylalanyllysy… threonylglycylglutamylprolylarginylpro… lthreonyllysylaspartylglycyllysylalany… lycyllysyltyrosyllysylleucylserylgluta… lanylphenylalanylleucylglutamylisoleuc… onylserylaspartylserylglycylleucyltyro… sylasparaginylserylalanylglycylserylva… cylthreonylisoleucyllysylalanylisoleuc… ylglutaminyllysylvalylserylthreonylglu… oleucylthreonylprolylglutaminyllysylly… ylglutamylisoleucylserylglutaminyllysy… utamylisoleucyllysylmethionylserylglut… myllysylleucylalanylleucyllysylglutamy… lisoleucylserylglutamylglutamylvalylly… rylleucylglutamyllysylserylisoleucylva… lthreonyllysylthreonylserylglutaminyla… nylthreonylhistidylalanylglutamylisole… eonylglutaminylmethionylserylisoleucyl… arginylleucylvalylleucyllysylalanylasp… threonylaspartylvalyllysyltryptophylva… amylleucylthreonylasparaginylserylglut… ycylvalylserylglycylserylaspartylgluta… llysylglutaminylalanylserylhistidylarg… leucylthreonylcysteinylisoleucylseryll… eucylvalyllysylcysteinylglutaminyltyro… llysylglutamylleucylserylaspartylalany… erylglutaminylprolylarginylserylglutam… glutamylglycylglutaminylasparaginylval… ylglutamylisoleucylserylglycylglutamyl… lutamyltryptophylphenylalanyllysylaspa… ucylserylisoleucylserylserylasparaginy… ylarginylasparaginylvalyltyrosylseryll… ginylalanylserylvalylserylaspartylsery… llysylalanyllysylasparaginylphenylalan… erylalanylthreonylalanylserylleucylmet… lutamylglutamylprolylserylarginylgluta… erylglycylaspartylthreonylserylleucylg… ylserylglutaminylserylvalylglutaminylm… inylglutamylalanylserylphenylalanylser… erylalanylserylserylmethionylthreonylg… anylserylmethionylserylalanylglutaminy… lutaminylglutamylserylphenylalanylvaly… rylphenylalanylmethionylglycylisoleucy… lutaminylleucylglutamylserylserylthreo… anylglycylisoleucylarginylglycylisoleu… ylalanylleucylprolylserylaspartylisole… lycyllysylvalylleucylthreonylvalylalan… ylglycylglutamylprolylthreonylprolylgl… ysteinylglycylglycylarginyllysylisoleu… lutaminylglycylarginylphenylalanylhist… eonylaspartylaspartylleucylthreonylthr… nylaspartylvalylglutaminyllysylglutami… lthreonylleucylserylleucylglycylaspara… laspartylserylalanylthreonylvalylaspar… inylserylisoleucine




Full chemical name of titin 

Methionylthreonylthreonylglutaminylala…
ylglutaminylprolylleucylglutaminylsery…
lserylthreonylalanylthreonylphenylalan…
rylglycylphenylalanylprolylvalylprolyl…
lanylarginylaspartylglycylglutaminylva…
nylleucylprolylglycylvalylglutaminylis…
ylglycylarginylalanyllysylleucylthreon…
llysylalanylasparaginylserylglycylargi…
eonylasparaginylglycylserylglycylgluta…
nylglutamylleucylleucylvalyllysylalany…
asparaginylphenylalanylvalylglutaminyl…
ylthreonylvalylarginylglutaminylglycyl…
utaminylvalylarginylvalylthreonylglycy…
lylvalyllysylphenylalanyltyrosylarginy…
cylglutaminylserylserylleucylaspartylp…
glutaminylglutamylglycylaspartylleucyl…
anylglutamylalanyltyrosylprolylglutamy…
serylvalylasparaginylalanylthreonylasp…
ylthreonylserylthreonylalanylglutamyll…
tamylglutamylglutamylvalylprolylalanyl…
eucylvalylserylthreonylalanylglutaminy…
glutaminylthreonylarginylisoleucylglut…
ylhistidylphenylalanylaspartylalanylar…
lylglutamylmethionylvalylisoleucylaspa…
nylglutaminylleucylprolylhistidyllysyl…
lprolylprolyllysylprolyllysylserylargi…
erylisoleucylalanylalanyllysylalanylgl…
ylglutaminylserylprolylserylprolylisol…
lprolylvalylarginylhistidylvalylarginy…
lylvalylarginylserylvalylserylprolylal…
onylserylprolylisoleucylarginylserylva…
thionylarginyllysylthreonylglutaminyla…
ylglycylprolylglutamylvalylprolylproly…
tamylglycyltyrosylvalylalanylserylsery…
ylarginylglutamylthreonylthreonylleucy…
minylisoleucylarginylthreonylglutamylg…
cylarginyltyrosylglycylvalylglutaminyl…
eucylserylglycylalanylalanylglycylalan…
serylalanylseryltyrosylalanylalanylglu…
lalanyllysylglutamylvalyllysylglutamin…
lanylalanylvalylalanylthreonylvalylval…
lalanylarginylvalylarginylglutamylprol…
tamylglutaminylthreonylalanylglutaminy…
eonylalanylvalylhistidylisoleucylgluta…
glutaminylvalylarginyllysylglutamylala…
threonyllysylvalylvalylvalylalanylalan…
lutaminylglutamylleucyllysylserylargin…
leucylthreonylthreonyllysylglutaminylg…
alylthreonylhistidylglutamylglutaminyl…
ylglutamyllysylthreonylphenylalanylval…
ylalanylalanyllysylalanyllysylglutamyl…
oleucylserylglutamylglutamylisoleucylt…
taminylvalylthreonylglutaminylglutamyl…
ylthreonylarginyllysylthreonylvalylval…
nylthreonylprolyllysylvalyllysylglutam…
larginylglycylarginylglutamylglycyliso…
lutamylglutaminylvalylglutaminylisoleu…
ethionylarginyllysylglutamylalanylglut…
hreonylisoleucylalanylvalylalanylthreo…
utaminylglutamylthreonylisoleucylleucy…
onylmethionylalanylthreonylarginylglut…
utaminylvalylthreonylhistidylglycyllys…
lalanylglutamylalanylvalylalanylthreon…
ylglutaminylalanylarginylvalylarginylg…
lycylhistidylleucylglutamylglutamylser…
threonylthreonylleucylglutamyltyrosylg…
leucylserylalanylalanyllysylvalylalany…
nylprolylalanylserylglutamylprolylhist…
llysylprolylarginylvalylisoleucylgluta…
nylhistidylisoleucyllysylthreonylthreo…
hionylhistidylisoleucylserylserylgluta…
eonylaspartylleucylthreonylthreonylglu…
laspartyllysylarginylprolylarginylthre…
alanylthreonylvalylseryllysylisoleucyl…
ylhistidylglycyltyrosylglutamylalanyls…
lisoleucylalanylthreonylleucylglutamin…
eonylserylserylalanylglutaminyllysylis…
alanylprolylthreonylvalyllysylprolylse…
nylalanylglutamylprolylthreonylprolyll…
olylphenylalanylalanylaspartylthreonyl…
erylglutamylalanylglycylvalylglutamylv…
lylserylisoleucylthreonylglycylthreony…
ylarginylphenylalanylglutamylvalylleuc…
yllysylvalylthreonylglutamylthreonylal…
alylglutamylisoleucylprolylvalylthreon…
rylglycylleucyllysylasparaginylvalylth…
lutamylserylvalylthreonylleucylglutamy…
cyltyrosylprolylserylprolylthreonylval…
lutamylaspartyltyrosylglutaminylisoleu…
tylphenylalanylglutaminylisoleucylthre…
ylisoleucylalanylarginylleucylmethiony…
ylalanylalanylglutamylaspartylserylgly…
inylserylalanylvalylasparaginylglutamy…
onylserylcysteinyltyrosylleucylalanylv…
tamylphenylalanylglutamyllysylglutamyl…
glutamyllysylphenylalanylthreonylthreo…
ylalanylvalylglutamylserylarginylaspar…
tylthreonylserylleucylthreonylglutamyl…
lglycylglutamylprolylalanylalanylproly…
yllysylprolylvalylvalylglutaminyllysyl…
lvalylvalylphenylalanylglycylcysteinyl…
nylprolyllysylprolylhistidylvalyltyros…
lylprolylleucylthreonylthreonylglycylt…
tyrosylasparaginyllysylglutaminylthreo…
ylvalylisoleucylserylmethionylthreonyl…
lanylglycylglutamyltyrosylthreonylisol…
sylhistidylglycylglutamylthreonylseryl…
lutamylglutamylalanylaspartyltyrosylgl…
ylglutaminylglutaminylglutamylmethiony…
taminylvalylthreonylalanylphenylalanyl…
ylvalylglycylglutamylthreonylalanylpro…
rylglutamyltyrosylglutamyllysylglutamy…
inylalanylleucylisoleucylarginyllysyll…
eonylvalylvalylvalylarginylthreonyltyr…
glutamylphenylalanylhistidylisoleucyls…
ylarginylleucylisoleucyllysylglutamyli…
ucylisoleucyllysylthreonylthreonylleuc…
mylglutamylaspartylglycylglutamylgluta…
lisoleucylserylglutamylserylglutamylal…
lanylaspartylleucylarginylisoleucyllys…
lleucylglutamylglycylmethionylglycylva…
einyllysylmethionylserylglycyltyrosylp…
yltryptophyltyrosyllysylaspartylglycyl…
lycylglutamylarginyltyrosylglutaminylm…
lutaminylaspartylglycylarginylalanylse…
lvalylleucylprolylglutamylaspartylglut…
lanylphenylalanylalanylserylasparaginy…
nylisoleucylcysteinylserylglycyllysyll…
ylalanylprolylleucylglycylalanylprolyl…
nylleucylglutamylprolylvalylserylargin…
rolylarginylserylvalylserylarginylsery…
ylprolylalanylarginylmethionylserylpro…
lalanylarginylmethionylserylprolylalan…
arginylarginylleucylglutamylglutamylth…
ylleucylglutamylarginylleucyltyrosylly…
yllysylprolylvalylserylphenylalanyllys…
ylasparaginylcysteinylarginylphenylala…
cylarginylprolylmethionylprolylglutamy…
ylalanylhistidylaspartylglycylglutamin…
ylaspartyltyrosylthreonylhistidyllysyl…
artylglycylthreonylglutaminylserylleuc…
ylthreonylprolylserylaspartylserylglyc…
lylalanylglutaminylasparaginylarginyla…
ylserylvalylisoleucylleucylthreonylval…
ylglutaminylvalyllysylprolylmethionylp…
lysylasparaginylvalylasparaginylisoleu…
eucylglutamylmethionyllysylvalylarginy…
lylasparaginylprolylaspartylisoleucylv…
lserylaspartylisoleucylisoleucylvalylp…
lisoleucylarginylisoleucylglutamylglyc…
alanylleucyllysylisoleucylaspartylsery…
ylserylalanyltryptophyltyrosylthreonyl…
ginyllysylalanylglycylarginylaspartylt…
lvalylasparaginylvalylglutamylvalylglu…
ylglutamylprolylglutamylarginyllysylle…
glycylthreonyltyrosylarginylalanyllysy…
lglutamylleucylglutamylprolylleucylhis…
aminylglutamylglutaminyltryptophylglut…
osylaspartyllysylglutamyllysylglutamin…
phenylalanyllysyllysyllysylleucylthreo…
inylphenylalanylglycylprolylalanylhist…
ginylleucylthreonylprolylisoleucylsery…
ylvalylglutamyltryptophylleucylhistidy…
tamylalanylalanylasparaginylarginylleu…
inylglutamylphenylalanylglycyltyrosylc…
lycylvalylalanyltyrosylserylarginylasp…
hreonylcysteinylarginylalanylthreonyla…
laspartylhistidylthreonylserylalanylth…
rtylglutamyllysylserylleucylvalylgluta…
lylglutamylglycylarginyllysylglycylleu…
ylglutamylleucylglutamylarginylmethion…
lleucylthreonylglycylvalylthreonylthre…
lysylglutaminyllysylprolylaspartylisol…
ylprolylvalylarginylvalylleucylglutamy…
lphenylalanylarginylcysteinylarginylva…
minylprolyllysylvalylasparaginyltrypto…
lutaminylleucylisoleucylarginyllysylse…
alylarginyltyrosylaspartylglycylisoleu…
leucylvalylaspartylcysteinyllysylseryl…
ylvalyllysylvalylthreonylalanylglutamy…
ylisoleucylglutamylhistidyllysylvalyll…
ylglutaminylarginylglutamylaspartylphe…
inylarginylalanylprolylglutamylprolyla…
tidylvalylhistidylglutamylprolylglycyl…
utamylvalylglutaminyllysylvalylasparty…
threonylglutamylthreonyllysylglutamylv…
nylglutamylarginylisoleucylthreonylhis…
ylglutamylserylglutamylglutamylleucyla…
ginylarginylthreonylglutamylglutamylgl…
leucylthreonylalanylvalylglutamylleucy…
lglutamylseryltyrosylglutamylglutamyll…
laspartylglutamylleucylleucylhistidylt…
lthreonylglutamylglutamylglutamyllysyl…
amylglycyllysylisoleucylthreonylisoleu…
rolylaspartyllysylisoleucylglutamylleu…
lalanylprolyllysylisoleucylphenylalany…
serylglutaminylthreonylvalylglycylglut…
idylphenylalanylarginylvalylarginylval…
lylglutamylcysteinylglutamyltryptophyl…
ysylisoleucylglutamylarginylserylaspar…
ltyrosyltryptophylprolylglutamylaspart…
leucylvalylisoleucylarginylaspartylval…
ylalanylserylisoleucylmethionylvalylly…
cylalanylglycylglutamylthreonylserylse…
leucylvalylglutaminylalanyllysylglutam…
anylthreonylglutaminylglutamylleucylgl…
ylglutamyllysylaspartylthreonylmethion…
lcysteinylglutamylthreonylserylglutamy…
ysyltryptophyltyrosyllysylaspartylglyc…
tamylglycylaspartyllysyltyrosylarginyl…
yllysylvalylhistidylphenylalanylleucyl…
ylaspartylthreonylserylaspartylalanylg…
lvalylleucylvalylglutamylaspartylgluta…
eonylalanyllysylleucylisoleucylvalylgl…
lphenylalanylvalyllysylglutamylleucylg…
alylprolylglutamylseryltyrosylserylgly…
soleucylvalylserylprolylglutamylaspara…
yptophyltyrosylhistidylasparaginylaspa…
paraginylglycyllysyltyrosylthreonyliso…
ycylarginylglutaminylasparaginylleucyl…
onyllysylglutamylaspartylglutaminylgly…
valylisoleucylaspartylglycyllysyllysyl…
llysylmethionyllysylprolylarginylproly…
aminylglycylleucylserylaspartylglutami…
laspartylisoleucylvalylglutaminylleucy…
glutamylserylvalylglutamylglycylvalylt…
ylglutaminylglutamylvalylglutaminylpro…
lisoleucylvalylisoleucylaspartyllysylg…
ylleucylisoleucylglutamylaspartylmethi…
anylglycylasparaginyltyrosylserylpheny…
lleucylglycylleucylserylthreonylserylg…
erylvalylaspartylvalylisoleucylthreony…
raginylvalylisoleucylglutamylglycylthr…
cysteinyllysylvalylserylvalylprolylasp…
yptophyltyrosylleucylasparaginylaspart…
rolylaspartylaspartylarginylvalylgluta…
lthreonyllysylglutaminylarginylleucylv…
onylhistidylalanylserylaspartylglutamy…
eucylvalylglycylarginylvalylglutamylth…
ylleucylserylvalylglutamyllysylisoleuc…
cylleucylarginylaspartylleucylthreonyl…
utaminylasparaginylvalylvalylphenylala…
histidylserylglycylisoleucylaspartylva…
lalanyllysylaspartyllysylglutamylisole…
yllysylisoleucylglutamylalanylhistidyl…
cylthreonylvalylleucylasparaginylmethi…
lutamylglycyllysyltyrosylthreonylpheny…
sparaginylmethionylthreonylserylglycyl…
lglycylalanylisoleucylseryllysylprolyl…
eonylvalylalanylglutamylserylglutaminy…
tamylcysteinylglutamylvalylalanylaspar…
lglutamyltryptophylleucylarginylaspart…
ucylthreonylasparaginylasparaginylisol…
tylglycylhistidyllysylarginylarginylle…
hreonyllysylleucylaspartylaspartylisol…
yrosyllysylvalylalanylthreonylseryllys…
ylvalylglutamylalanylvalyllysylisoleuc…
raginylleucylthreonylvalylthreonylglut…
lvalylphenylalanylthreonylvalylglutamy…
ginylvalyllysylglycylvalylglutaminyltr…
ycylvalylvalylleucylglutamylserylaspar…
leucylserylvalyllysylglycylthreonyliso…
eucyllysylasparaginylcysteinylalanylis…
lyltyrosylglycylphenylalanylarginylleu…
erylalanylarginylleucylhistidylvalylgl…
oleucyllysyllysylprolyllysylaspartylva…
raginylalanylthreonylvalylalanylphenyl…
istidylaspartylthreonylvalylprolylvaly…
llysylserylvalylglutamylisoleucyllysyl…
inylleucylvalylserylglutamylarginyllys…
leucylglutaminylasparaginylisoleucylse…
lutamyltyrosylthreonylalanylvalylvalyl…
inyllysylalanyllysylleucylphenylalanyl…
isoleucylthreonyllysylthreonylmethiony…
alylprolylglutamylthreonyllysylthreony…
teinylglutamylvalylserylhistidylphenyl…
thionyltryptophylleucyllysylasparaginy…
ylmethionylserylglutamyllysylphenylala…
ylglycyllysylleucylhistidylglutaminyll…
araginylthreonylserylthreonylglutamyla…
reonylphenylalanylvalylcysteinylglycyl…
erylalanylthreonylleucylthreonylvalylt…
eucylthreonylserylmethionylleucyllysyl…
lutamylglutamyllysylaspartylthreonylis…
valylthreonylvalylasparaginyltyrosylgl…
syltryptophylleucyllysylasparaginylgly…
threonylaspartyllysylcysteinylglutamin…
lleucylthreonylhistidylserylleucylaspa…
alylhistidylphenylalanylglycylaspartyl…
phenylalanylvalylalanylglycyllysylalan…
ylleucyltyrosylvalylglutamylalanylargi…
lanylarginyllysylhistidylisoleucyllysy…
lutamyllysyllysylarginylalanylmethiony…
mylvalylserylglutamylprolylaspartyliso…
phylmethionyllysylaspartylaspartylglut…
ucylthreonylaspartylarginylisoleucylly…
lysyltyrosylvalylhistidylarginylleucyl…
rginylmethionylserylaspartylalanylglyc…
nylglycylglycylasparaginylvalylserylth…
valylglutamylglycylarginylaspartylvaly…
cyllysyllysylglutamylvalylglutaminylva…
arginylalanylvalylvalylglutamylphenyla…
ylaspartylaspartylvalylaspartylalanylh…
ylglycylisoleucylglutamylisoleucylaspa…
lutaminylglutamylarginylhistidyllysylt…
nylisoleucylhistidylarginylmethionylph…
eonylarginylglutaminylserylaspartylala…
nylalanylvalylalanylglycylarginylaspar…
lleucyltyrosylvalylasparaginylalanylpr…
alylleucylglutaminylglutamylleucylglut…
minylserylglycyllysylprolylalanylargin…
nylisoleucylserylglycylarginylprolylgl…
yptophyltyrosyllysylglutamylglutamylgl…
ycylphenylalanyllysylcysteinyllysylphe…
ylglutaminylglutamyltyrosylthreonylleu…
nylphenylalanylprolylglutamylaspartyla…
einylglutamylalanyllysylasparaginylasp…
ylthreonylserylalanylserylleucylserylv…
lvalylserylprolylaspartylglutaminylglu…
lylprolylalanylisoleucylisoleucylthreo…
reonylvalylthreonylserylglutamylglycyl…
alanylglutaminylcysteinylarginylvalyls…
ylvalylseryltryptophyltyrosylseryllysy…
olylserylarginylphenylalanylphenylalan…
lphenylalanylglutamylaspartylthreonylt…
ucylalanylglutamylalanyltyrosylprolylg…
yltyrosylthreonylphenylalanylvalylalan…
glycylglutaminylvalylserylserylthreony…
glutamylalanylprolylglutamylserylisole…
oleucylglutamylglutaminylglutamylisole…
nyllysylglutamylphenylalanylserylseryl…
lutamylglutamylglutamylglycylleucylhis…
minylleucylseryllysylisoleucylasparagi…
ucylleucylserylglutamylserylprolylvaly…
anylaspartylserylglutamyllysylglutamyl…
phenylalanylisoleucyllysylglutamylvaly…
eucylserylmethionylglycylaspartylvalyl…
nylvalylisoleucylglycylisoleucylprolyl…
tryptophylphenylalanylphenylalanylaspa…
nylprolylserylalanylaspartyltyrosyllys…
rtylglycylaspartylaspartylhistidylsery…
ylalanylthreonyllysylleucylglutamylasp…
hreonylcysteinylmethionylalanylserylas…
threonylisoleucylcysteinylserylalanylt…
ylseryllysylglycylglutamylglycylhistid…
onylglutamylserylalanylvalylalanyllysy…
ylglycylprolylcysteinylprolylprolylhis…
lleucyllysylprolylisoleucylarginylcyst…
olylalanylisoleucylphenylalanylglutamy…
tamylprolylalanylprolylthreonylvalylth…
utamylasparaginyllysylglutaminylleucyl…
yrosylthreonylisoleucylisoleucylhistid…
lserylglycylthreonylphenylalanylisoleu…
utaminylarginylglutamylaspartylserylgl…
lysylalanylglutamylasparaginylmethiony…
ysteinylalanylalanylglutamylleucylleuc…
threonylaspartylmethionylthreonylaspar…
yllysylserylthreonylprolylglutamylalan…
lprolylglutaminylthreonylprolylleucyll…
alanylleucylaspartylserylglutamylgluta…
lphenylalanylvalyllysylaspartylthreony…
ucylisoleucylthreonylglutamylglutamyla…
lseryltyrosylglutamylhistidylisoleucyl…
lleucylserylserylglutaminylleucylproly…
ylleucylglutaminylserylisoleucylleucyl…
ylthreonylprolylglutamylserylthreonyla…
teinylisoleucylasparaginylglycylseryli…
nylprolylleucyllysylglutamylprolylsery…
eucylglutaminylisoleucylvalylglutaminy…
alanylseryllysylglutamylglycylisoleucy…
mylprolylglutamylthreonylglutaminylala…
glutamyllysylisoleucylphenylalanylprol…
lglutamylglutaminylisoleucylasparaginy…
olylleucyllysylthreonylleucylleucylala…
raginyltyrosylprolylglutaminylserylser…
ionylhistidylseryltyrosylleucylthreony…
lylleucylserylleucyllysylglutamyllysyl…
sparaginylarginylglutamylglutaminylarg…
sylglutaminylglutamylalanylglutaminyls…
lglutaminylserylleucylalanylglutamylgl…
lglutaminylserylprolylaspartylvalylmet…
asparaginyltyrosylglutamylprolylleucyl…
ylcysteinylthreonylglutamylglycylglycy…
mylserylalanylasparaginylprolylleucylg…
minylaspartylserylalanylvalylarginylis…
erylleucylarginylphenylalanylprolylleu…
lglutaminylvalylleucylleucyllysylgluta…
araginylvalylvalylmethionylprolylproly…
ylglutamylseryllysylarginylglutamylpro…
lylglutaminylglutamylvalylglutaminylgl…
llysylglutamylserylleucylleucylserylgl…
glutaminylarginylleucylasparaginylleuc…
cysteinylarginylalanylleucylglutaminyl…
lglutaminylprolylglycylleucylphenylala…
inylasparaginylisoleucylglutamyllysylv…
lasparaginylisoleucylthreonylglutaminy…
ucylmethionylcysteinylmethionyltyrosyl…
serylvalylthreonylglutamylglutamylvaly…
lglutamylaspartylvalylaspartylprolylgl…
eucyllysylmethionylglutamylleucylargin…
ylisoleucylisoleucyltyrosylglutamylglu…
ylthreonylalanylglutamylglycylprolylar…
lycylalanyllysylthreonylserylleucylglu…
artylserylphenylalanylserylglycylseryl…
soleucylthreonylglutamylprolylglutamyl…
lisoleucylserylthreonylglutamylglutamy…
aginylvalylglutaminylserylarginylvalyl…
eonylprolylvalylthreonyllysylglycylval…
spartylglutamyllysylglutaminylaspartyl…
glutamylglutamyllysylglutamylglutamyls…
reonylglutamylglutamylvalylalanylthreo…
tamylalanylglutamylglycylglycylleucyli…
prolylmethionylisoleucylhistidylthreon…
valylserylglutamylglutamylglycylaspart…
nylthreonylserylisoleucylthreonylaspar…
aginyltryptophyltyrosylphenylalanylglu…
lylserylaspartylglutamyllysylphenylala…
partylglutaminylasparaginylthreonyltyr…
artyllysylvalylasparaginylthreonylglut…
lglutamyltyrosylvalylcysteinylglutamyl…
lglycyllysylthreonylalanylthreonylsery…
llysylarginylalanylalanylprolylvalylis…
utamylprolylleucylglutamylvalylalanyll…
lphenylalanylthreonylcysteinylglutamyl…
lasparaginylvalylarginylphenylalanylgl…
alanylglycylarginylglutamylisoleucylty…
einylserylisoleucylarginylserylserylly…
glutamylisoleucylleucylarginylthreonyl…
ylglycylglutamyltyrosylthreonylcystein…
yltyrosylglycylserylvalylserylcysteiny…
ylvalylthreonylvalylprolylglycylglycyl…
leucylleucylprolylglutamylarginyllysyl…
utamylvalylvalylleucyllysylserylvalyll…
mylglutamylglutamylglutamylprolyllysyl…
glutamyllysylvalyllysyllysylprolylalan…
olylprolyllysylprolylvalylglutamylglut…
lvalylthreonyllysylarginylglutamylargi…
ylthreonyllysylvalylprolylglutamylisol…
ylleucylprolylalanylprolylglutamylprol…
nylglutamylvalyllysylthreonylisoleucyl…
lprolylglutamylprolylthreonylprolyliso…
ylvalylprolylvalylvalylglycyllysyllysy…
lyllysylglutamylglutamylalanylalanylly…
lysylglycylvalylprolyllysyllysylthreon…
lalanylglutamylarginylarginyllysylleuc…
cylglutamyllysylprolylprolylaspartylgl…
nyltyrosylglutaminylleucyllysylalanylv…
lyllysylglutamylisoleucyllysylaspartyl…
tamylserylglutamylphenylalanylvalylgly…
lanylglutamylcysteinylleucylvalylseryl…
hreonylthreonyltryptophylmethionyllysy…
eucylarginylglutamylserylprolyllysylhi…
lanylaspartylglycyllysylaspartylarginy…
cylaspartylvalylglutaminylleucylseryla…
hreonylcysteinylvalylleucylarginylleuc…
ylthreonylserylthreonylalanyllysylleuc…
rolylvalylarginylphenylalanylvalyllysy…
amylvalylthreonylvalylvalyllysylglycyl…
serylcysteinylglutamylleucylasparaginy…
alyltryptophylarginyllysylaspartylglyc…
ysylprolylglycylarginylisoleucylvalylp…
ylmethionylarginylalanylleucylthreonyl…
spartylaspartylthreonylaspartylalanylg…
reonylvalylglutamylasparaginylalanylas…
ysteinylserylserylcysteinylvalyllysylv…
nylaspartyltryptophylleucylvalyllysylp…
inylhistidylvalyllysylprolyllysylglycy…
lalanylcysteinylaspartylisoleucylalany…
inylisoleucyllysyltryptophylphenylalan…
lisoleucylprolylalanylglutamylprolylas…
mylisoleucylleucylarginylaspartylglycy…
ucyllysylisoleucyllysylasparaginylalan…
oleucylalanylglutamyltyrosylalanylvaly…
ylarginyltyrosylprolylalanyllysylleucy…
lglutamylvalylglutamylleucylleucyllysy…
ylthreonylisoleucyltyrosylglutamyllysy…
ylaspartylalanylglutamylisoleucylseryl…
ylglycylglutaminyltryptophyllysylleucy…
inylprolylserylprolylthreonylcysteinyl…
lglycylglycyllysylarginylphenylalanyll…
yllysylleucylaspartylglutaminylalanylg…
aminylalanylleucylasparaginylalanyliso…
ylleucylthreonylvalyllysylglutamylisol…
anylalanylvalylprolylleucyllysylaspart…
rginylarginylglutaminylalanylarginylph…
cylthreonylarginylglutamylalanylaspara…
ysylglycylprolylaspartylisoleucylisole…
nylalanylaspartylisoleucylisoleucylala…
isoleucylleucylvalylisoleucylasparagin…
ylaspartylaspartylglutamylglycylvalylt…
utamylglycyllysyllysylthreonylserylala…
reonylglycylisoleucylarginylleucyllysy…
ucylglutamylaspartylglutaminylthreonyl…
eonylalanylthreonylphenylalanylvalylcy…
lutamyllysylmethionylhistidylvalylvaly…
inylaspartylalanyllysylleucylhistidylt…
cylisoleucylserylserylglutamylglycylly…
mylmethionyllysylglutamylvalylthreonyl…
lglutaminylisoleucyllysylalanylglutami…
ylthreonylalanylglutaminylleucyllysylv…
lyltyrosylphenylalanylthreonylvalyllys…
ylalanylvalylglutamyllysylaspartylglut…
teinylglutamylvalylseryllysylaspartylv…
lalanyllysylaspartylglycylglutamylglut…
lysyltyrosylserylisoleucyllysylalanyla…
oleucylleucyllysylisoleucyllysyllysyla…
ylglycylglutamyltyrosylvalylcysteinyla…
tyllysylthreonyllysylalanylasparaginyl…
inylleucylisoleucylglutamylvalylglutam…
ylglutamylvalylphenylalanylvalylglycyl…
lalanylglutamylisoleucylglutamylleucyl…
tidylglycylglutaminyltryptophyllysylle…
ylthreonylalanylserylprolylaspartylcys…
tamylaspartylglycyllysyllysylhistidyli…
ylasparaginylcysteinylglutaminylleucyl…
ylvalylserylphenylalanylglutaminylalan…
alanylalanylasparaginylleucyllysylvaly…
leucylphenylalanylisoleucylthreonylpro…
ylphenylalanylglutamyllysylaspartylglu…
lcysteinylglutamylvalylserylarginylglu…
larginyltryptophylleucyllysylglycylthr…
eonylglycylaspartylaspartylarginylphen…
laspartylglycylthreonyllysylhistidylse…
lalanylalanylphenylalanylglutamylaspar…
nylphenylalanylglutamylalanylglutamyla…
ycyllysylleucylisoleucylisoleucylgluta…
lphenylalanylleucylthreonylprolylleucy…
sylglutamyllysylglutamylserylalanylval…
leucylserylhistidylaspartylasparaginyl…
lphenylalanyllysylasparaginylaspartylg…
nylthreonylarginylserylvalylserylmethi…
llysylthreonylhistidylserylisoleucylth…
ylserylisoleucylaspartylaspartylthreon…
lylglutamylalanylmethionylglycylmethio…
cylthreonylvalylleucylglutamylglycylas…
onylglycyllysylleucylglutaminylasparty…
lysylaspartylglutamylvalylisoleucylleu…
ucylseryllysylalanylaspartylalanylprol…
ysylaspartylglycyllysylglutamylisoleuc…
lanylvalylisoleucyllysylthreonylaspart…
eucylisoleucylleucyllysyllysylalanylle…
ylglutaminyltyrosylthreonylcysteinylas…
yllysylthreonylserylglycyllysylleucyla…
inylglutamylisoleucyllysylleucylvalyla…
lglutamylvalylmethionylglutamylthreony…
lalanylglutamylthreonylglutamylisoleuc…
eucylhistidylalanylasparaginyltryptoph…
nylleucylleucylglutaminylthreonylproly…
lysylglutamylglutamylglycyllysylisoleu…
stidylasparaginylcysteinylarginylleucy…
ycylvalylaspartylphenylalanylglutaminy…
erylserylalanylhistidylleucylarginylva…
glycylleucylleucylarginylprolylleucyll…
nylalanylglycylglutamylthreonylalanylt…
lglutamylleucylseryltyrosylglutamylasp…
yptophyltyrosylleucyllysylglycyllysyll…
yllysylvalylvalylprolylarginylserylglu…
ylleucylthreonylleucylarginylaspartylv…
ylglycylglutamylvalylglutaminylleucylt…
nyllysylthreonylhistidylalanylasparagi…
amylprolylprolylvalylglutamylphenylala…
laspartylglutaminylthreonylvalylglutam…
lvalylleucylglutamylcysteinylglutamylv…
alanyllysylvalyllysyltryptophylphenyla…
glutamylisoleucylleucyllysylseryllysyl…
lanylaspartylglycylarginylvalylarginyl…
partylcysteinylthreonylprolylglutamyla…
lthreonylcysteinylaspartylalanyllysyla…
ylcysteinylasparaginylleucylasparaginy…
lglutamylphenylalanylleucylarginylprol…
minylvalylarginylglutamyllysylglutamyl…
lutamylcysteinylglutamylleucylserylarg…
alyllysyltryptophylphenylalanyllysylas…
lysyllysylglycyllysyllysyltyrosylaspar…
ylalanylvalylarginylisoleucylleucylval…
lleucylleucylaspartylaspartylglutamyla…
lutamylvalylarginylthreonylalanylargin…
lthreonylvalylleucylglutamylglutamylgl…
yllysylasparaginylleucylalanylasparagi…
mylthreonylaspartylthreonylisoleucylly…
lseryllysylprolylglycylalanylglutamylv…
glycylaspartylglutamylglutamylisoleucy…
inyltyrosylglutamylisoleucylleucylthre…
ylisoleucylleucylvalylisoleucylglutami…
lutamylaspartylalanylglycylasparaginyl…
eucylprolylserylserylarginylthreonylas…
tidylglutamylleucylalanylalanylglutamy…
lylglutaminylasparaginylleucylglutamyl…
yllysylalanylglutamylphenylalanylvalyl…
utamylserylphenylalanylprolylvalylglut…
laspartyllysylthreonylleucylglutamylse…
ylvalylisoleucylalanylaspartylglycylly…
llysylaspartylalanylthreonylleucylglut…
yltyrosylvalylvalylmethionylvalylglycy…
nylhistidylleucylthreonylvalylisoleucy…
lvalylvalylprolylleucyllysylaspartylth…
aminylglutaminylglutamylvalylvalylphen…
lvalylasparaginylthreonylglutamylglycy…
enylalanylarginylasparaginylglutamylgl…
partylserylseryllysyltyrosylisoleucyli…
ylleucylvalyltyrosylthreonylleucylargi…
stidylleucylaspartylaspartylglutaminyl…
valylserylleucylthreonylasparaginylhis…
ylvalyllysylserylalanylalanylasparagin…
mylglutamylaspartylleucylarginylisoleu…
partylisoleucylglutamylthreonylmethion…
nylphenylalanyltryptophylcysteinyllysy…
aginylvalylthreonylleucyllysyltryptoph…
tamylglutamylvalylprolylphenylalanylas…
yrosylarginylvalylaspartyllysyltyrosyl…
lisoleucyllysylaspartylcysteinylglycyl…
lycylglutamyltyrosylisoleucylvalylthre…
ysylserylvalylalanylglutamylleucylleuc…
rolylthreonylglutamylphenylalanylvalyl…
tylglutaminylthreonylvalylthreonylglut…
nylvalylphenylalanylserylcysteinylglut…
ylalanylasparaginylvalyllysyltryptophy…
inylglutamylisoleucyllysylglutamylglyc…
lglutamyllysylaspartylglycylserylisole…
soleucyllysylaspartylcysteinylarginyll…
nylglutamyltyrosylalanylcysteinylglycy…
erylarginylalanylarginylleucylphenylal…
rolylvalylglutamylisoleucylisoleucylar…
isoleucylleucylglutamylalanylprolylgly…
anylleucylalanylglutamylleucylasparagi…
alylglutaminyltryptophylleucylarginyla…
valylvalylglutaminylglycylaspartyllysy…
ylserylglutamylglycyllysylisoleucylhis…
ylcysteinylaspartylisoleucyllysylproly…
tamyltyrosylarginylphenylalanylisoleuc…
lanylarginylalanyllysylleucylglutamyll…
soleucyllysylthreonylalanylaspartylglu…
rtylvalylglycyllysylprolylleucylthreon…
spartylalanyltyrosylprolyllysylalanylg…
ylalanyllysylglutamylasparaginylglutam…
eonylisoleucylaspartylthreonylthreonyl…
ylphenylalanylarginylisoleucylleucylgl…
llysylglycylarginyltyrosyllysylisoleuc…
ysylhistidylglycyllysylalanylglutamylg…
ylleucyllysylvalylisoleucylaspartylval…
araginylleucylglutamylvalylthreonylglu…
ycylglutamylvalylserylleucylalanyltryp…
hreonylaspartylglycylglycylseryllysyli…
valylglutamylarginylarginylaspartyliso…
tophylvalylleucylalanylthreonylasparty…
lglutamylphenylalanylthreonylvalylthre…
ylglycylvalylglutamyltyrosylleucylphen…
nylasparaginylarginylvalylglycylthreon…
threonylaspartylasparaginylprolylvalyl…
sylaspartylvalylprolylglycylprolylprol…
leucylthreonylaspartylvalylasparaginyl…
leucylthreonyltryptophylglutamylprolyl…
glycylalanylglutamylisoleucylthreonyla…
amylleucylarginylaspartyllysylthreonyl…
rtylthreonylalanylmethionylthreonylval…
ylserylalanylthreonylvalylthreonylaspa…
nylglutamyltyrosylserylphenylalanylarg…
araginylarginylisoleucylglycylvalylgly…
onylprolylphenylalanylvalyllysylvalyla…
larginylprolylserylprolylprolylvalylas…
partylglutaminylthreonylglutaminylsery…
ptophylglutamylprolylprolylleucyllysyl…
eucylleucylglycyltyrosylisoleucylisole…
lglutamylglycyllysylaspartylasparaginy…
lasparaginylmethionyllysylleucylvalylp…
ysylvalylthreonylglycylleucylglutamyll…
ucyltyrosylarginylvalylserylalanylglut…
ylserylaspartylprolylserylglutamylisol…
ylalanylaspartylaspartylalanylphenylal…
ionylaspartylleucylserylalanylphenylal…
ylvalylisoleucylvalylprolylasparaginyl…
cylvalylprolylserylthreonylglycyltyros…
threonyltryptophylcysteinylphenylalany…
amylthreonylglycylaspartylarginylvalyl…
rylalanyltyrosylalanylglutamylleucylva…
larginylserylaspartyllysylglycylisoleu…
glutamylasparaginylarginylvalyllysylth…
soleucylaspartylvalylasparaginylvalyli…
nylprolyllysylglutamylleucyllysylpheny…
nyllysylaspartylserylvalylhistidylleuc…
rolylaspartylaspartylaspartylglycylgly…
yrosylvalylvalylglutamyllysylarginylgl…
ltryptophylthreonyllysylvalylmethionyl…
partylleucylglutamylphenylalanylthreon…
taminylglycyllysylglutamyltyrosylleucy…
nylarginylasparaginyllysylcysteinylgly…
tyrosylvalylaspartylglutamylprolylvaly…
rolylalanylthreonylvalylprolylaspartyl…
llysyltryptophylarginylaspartylarginyl…
ucylphenylalanylleucylthreonyltryptoph…
nylaspartylglycylglycylserylarginyliso…
lylglutamylarginylcysteinylprolylargin…
lvalylalanylcysteinylglycylglutamylpro…
methionylglutamylvalylthreonylglycylle…
tophyltyrosylalanyltyrosylarginylvalyl…
ylglutaminylglycylalanylseryllysylprol…
lglutamylisoleucylglutaminylalanylvaly…
alanylprolylglutamylisoleucylphenylala…
ucylalanylglycylleucylthreonylvalyllys…
lglutamylleucylprolylalanylthreonylval…
prolyllysylisoleucylthreonyltryptophyl…
lisoleucylleucyllysylglutaminylasparty…
ucylglutamylasparaginylvalylprolyllysy…
leucylvalylaspartylseryllysylarginylse…
rosylisoleucylisoleucylglutamylalanylv…
arginylalanylthreonylalanylvalylvalylg…
spartyllysylprolylglycylprolylprolylal…
ucylthreonylaspartylvalylthreonylaspar…
eucylthreonyltryptophylasparaginylprol…
ylglycylseryllysylisoleucylthreonylasp…
ginylarginylalanylthreonylaspartylsery…
ylleucylserylserylthreonylvalyllysylas…
yllysylalanylthreonyllysylleucylisoleu…
rosylisoleucylphenylalanylarginylvalyl…
ionyltyrosylglycylalanylglycylglutamyl…
lylisoleucylthreonylalanyllysyltyrosyl…
lprolylglycylprolylprolylthreonylargin…
isoleucylthreonyllysylaspartylalanylva…
cysteinylglutamylprolylaspartylasparty…
leucylthreonylglycyltyrosyltryptophylv…
olylaspartylthreonylaspartyllysyltrypt…
yllysylmethionylprolylvalyllysylaspart…
yllysylglycylleucylthreonylasparaginyl…
alanylarginylvalylleucylalanylglutamyl…
glycyllysylprolylseryllysylserylthreon…
eucyllysylaspartylprolylisoleucylaspar…
ylglycyllysylprolylthreonylvalyllysyla…
lvalylarginylleucylasparaginyltryptoph…
ylaspartylglycylglycylalanyllysylisole…
cylglutamylmethionylleucyllysylthreony…
tophylvalylarginylvalylalanylglutamylg…
taminylhistidylleucylleucylprolylglycy…
minylglutamyltyrosylserylphenylalanyla…
ginyllysylalanylglycylglutamylserylglu…
aspartylprolylvalylleucylcysteinylargi…
prolylserylprolylprolylarginyltryptoph…
aginylisoleucylthreonyllysylasparaginy…
ryptophylthreonylvalylprolylglutamylly…
soleucylthreonylasparaginyltyrosylisol…
tylvalylarginylarginyllysylglycyltrypt…
lthreonylthreonylvalyllysylaspartylthr…
eonylprolylleucylthreonylglutamylglycy…
larginylvalylalanylalanylglutamylaspar…
ylserylaspartyltyrosylthreonylglutamyl…
leucylalanyllysylaspartylthreonylpheny…
prolylprolyltyrosylalanylleucylalanylv…
arginylhistidylvalylaspartylleucyllysy…
lasparaginylaspartylglycylglycylarginy…
rosylvalylisoleucylglutamyllysyllysylg…
rginyltryptophylvalyllysylalanylglycyl…
rtylcysteinylasparaginylphenylalanylar…
eucylglutamylglycylthreonylglutamylval…
alylarginylalanylglutamylasparaginylgl…
ylprolylserylglutamylprolylthreonylglu…
lutamylaspartylprolylthreonylserylprol…
rtylleucylhistidylvalylthreonylasparty…
oleucylalanylisoleucylalanyltryptophyl…
aginylglycylglycylserylprolylisoleucyl…
glutamylmethionylcysteinylprolylvalylg…
lmethionylarginylvalylasparaginylseryl…
leucyllysylphenylalanyllysylvalylgluta…
partyllysylglutamyltyrosylvalylleucyla…
ginylalanylisoleucylglycylvalylserylgl…
erylglutamylasparaginylvalylvalylalany…
yllysylprolylthreonylisoleucylaspartyl…
tylisoleucylisoleucylvalylisoleucylglu…
isoleucylprolylvalylprolylphenylalanyl…
threonylvalylseryltryptophylhistidylly…
lysylalanylserylaspartylarginylleucylt…
artylhistidylisoleucylserylalanylhisti…
rylvalylarginylalanylaspartylalanylgly…
lthreonylleucylglutamylasparaginyllysy…
nylserylisoleucylasparaginylvalyllysyl…
cylprolylcysteinyllysylaspartylisoleuc…
threonyllysylserylserylcysteinyllysyll…
ylprolylglutamylphenylalanylaspartylgl…
ucylhistidyltyrosylvalylleucylglutamyl…
rginylarginylthreonyltyrosylisoleucylp…
mylasparaginyllysylleucylseryltryptoph…
soleucylprolylasparaginylglycylglutamy…
inylvalyllysylalanylvalylasparaginylly…
yrosylisoleucylglutamylleucyllysylaspa…
utaminylaspartylprolyllysylglutaminylp…
laspartylvalylglutamylvalylhistidylasp…
lalanylmethionylthreonylisoleucylthreo…
ltyrosylaspartylglycylglycylseryllysyl…
eucylisoleucylglutamyllysylisoleucylal…
nyltryptophyllysylarginylcysteinylaspa…
rolylisoleucylleucylthreonyltyrosylthr…
lglutamylglycyllysylglutamyltyrosylglu…
nylalanylglutamylasparaginylalanylalan…
lserylarginylalanylthreonylprolylproly…
olylisoleucylaspartylalanylprolyllysyl…
serylleucylglutamylvalyllysylarginylgl…
leucylaspartylalanylserylisoleucylsery…
onylisoleucylthreonyltryptophylisoleuc…
alylisoleucylvalylprolylglutamylglutam…
lanylprolylleucylvalylarginylarginylar…
inylglutamylglutamylglutamylprolylphen…
onylglutaminylarginylleucylserylisoleu…
ylglycylglutamylserylglutaminylleucyla…
ylarginylprolylaspartylhistidylglycyll…
valylglutamylasparaginylaspartylhistid…
rolylcysteinylthreonylvalylserylvalyll…
olylprolylisoleucylasparaginylphenylal…
ylisoleucylarginyllysylthreonylserylva…
utamylprolylprolylleucylaspartylaspart…
lisoleucylasparaginyltyrosylthreonylle…
threonyllysylprolylaspartylserylglutam…
onylserylthreonylleucylarginylhistidyl…
onyllysylleucylisoleucylglutamylglycyl…
nylarginylvalylarginylalanylglutamylas…
rolylglycylprolylprolylcysteinylvalyls…
ylaspartylprolylphenylalanylglycylprol…
llysylprolylisoleucylvalylglutamylaspa…
rylmethionylleucylvalyllysyltryptophyl…
tylasparaginylglycylserylprolylisoleuc…
ylglutamyllysylarginylglutamylvalylasp…
phylserylarginylvalylasparaginyllysyls…
ucyllysylalanylasparaginylvalylasparty…
ucylthreonyltyrosylvalylphenylalanylar…
paraginylalanylalanylglycylprolylglycy…
serylaspartylprolyllysylthreonylalanyl…
lprolylprolylglycylprolylprolylisoleuc…
lthreonylserylserylthreonylthreonyliso…
hylglutamylprolylprolylalanylphenylala…
tamylisoleucylvalylglycyltyrosylphenyl…
eucylvalylglycylthreonylasparaginyllys…
reonylglutamyllysylmethionylisoleucyll…
reonylvalyllysylglutamylisoleucylargin…
yllysylleucylarginylvalylserylalanylva…
tamylglycylprolylprolylglycylglutamylt…
lvalylalanylglutamylprolylglutaminylgl…
ylleucylaspartylvalylserylvalyllysylgl…
cylmethionylalanylglycyllysylthreonyll…
lylvalylthreonylglycylarginylprolylval…
lthreonyllysylglutamylglutamylglycylgl…
ginylvalylvalylisoleucylaspartylaspara…
lutamylleucylisoleucylisoleucyllysylas…
tylhistidylglycylarginyltyrosylvalylis…
ginylserylcysteinylglycylseryllysylphe…
alylglutamylvalylphenylalanylaspartylv…
partylleucyllysylprolylvalylvalylthreo…
cysteinylleucylleucylasparaginyltrypto…
rtylaspartylglycylglycylserylglutamyli…
soleucylisoleucylglutamylarginyllysyla…
threonyltryptophylarginylglutaminylpro…
larginylseryllysylcysteinylaspartyliso…
tamylglycylglutaminylglutamyltyrosylly…
lalanyllysylasparaginyllysylphenylalan…
valylglutamylisoleucylglycylprolylisol…
lleucylglycylprolylprolylthreonylseryl…
tyrosylthreonylglutamylarginylglutamin…
onylleucylaspartyltryptophyllysylgluta…
cylglycylserylprolylisoleucylglutaminy…
tamyllysylarginylarginylhistidylaspart…
utamylarginylvalylasparaginyllysylargi…
eonylserylphenylalanylleucylvalylgluta…
lhistidylglutaminylmethionyltyrosylglu…
lanylvalylasparaginylglutamylisoleucyl…
rylleucylprolylleucylasparaginylvalylv…
rtylglutamylvalylprolylprolylthreonyli…
ylvalylarginylglycylaspartylthreonylis…
lutamylprolylvalylhistidylisoleucylpro…
lleucylprolylmethionylprolyllysylisole…
araginylglutamylthreonylvalylisoleucyl…
alanylleucylglutaminylisoleucylthreony…
inylserylglutamylalanyllysylthreonylgl…
ylalanylvalylarginylglutamylaspartylly…
ylthreonylalanylserylasparaginylarginy…
arginylasparaginylvalylhistidylvalylgl…
olylserylprolylprolylarginylasparaginy…
soleucyllysylalanylglutamylserylcystei…
spartylalanylprolylleucylaspartylaspar…
eucylthreonylhistidyltyrosylvalylisole…
nylserylarginyllysyllysylalanylglutamy…
eonylasparaginylthreonylalanylvalylglu…
ucyltryptophyllysylleucylisoleucylprol…
lglutamylphenylalanylarginylvalylargin…
lglycylisoleucylserylaspartylglutamylc…
lvalylisoleucylglutaminylaspartylproly…
olylprolylglycyllysylprolyllysylvalyll…
ylserylmethionylleucylvalylseryltrypto…
tylasparaginylglycylglycylserylprolyli…
phylleucylglutamyllysylarginylglutamyl…
ptophylserylarginylvalylserylarginylal…
ylglycylleucyllysylglycylvalylglutamyl…
rginylleucylleucylglutamylglycylvalyll…
ginylalanylmethionylalanylisoleucylasp…
glycylprolylprolylserylglutamylprolyls…
ylglycylaspartylprolylisoleucylphenyla…
serylcysteinylprolylglutamylvalyllysyl…
lisoleucylserylleucylglycyltryptophyll…
glycylglycylserylprolylisoleucyllysylg…
ethionylglutaminylglutamylglutamylglyc…
llysylarginylvalylasparaginylglutamylp…
reonylthreonylcysteinylglutamylcystein…
lysylglutamylleucylarginyllysyltyrosyl…
lalanylvalylasparaginylglutamylalanylg…
ylaspartylthreonylthreonylglycylglutam…
rtylisoleucylglutaminylglutamylglutamy…
leucylaspartylisoleucylglycylalanylglu…
cysteinyllysylalanylglycylserylglutami…
lanylvalylisoleucyllysylglycylarginylp…
ryptophylglutamylphenylalanylaspartylg…
hionyllysylaspartylglycylvalylhistidyl…
rtylalanylglutaminylleucylglutamylthre…
erylvalylisoleucylisoleucylisoleucylpr…
rylhistidylthreonylglycyllysyltyrosyls…
araginyllysylalanylglycylglutaminyllys…
larginylvalyllysylvalylmethionylaspart…
laspartylleucyllysylvalylserylaspartyl…
cysteinylarginylleucylseryltryptophyll…
aspartylglycylglycylaspartylarginyliso…
cylglutamyllysylarginylthreonylisoleuc…
ylthreonyllysylvalylasparaginylprolyla…
threonylphenylalanylvalylvalylprolylas…
aminylglutaminyltyrosylphenylalanylphe…
lutamylasparaginylarginylphenylalanylg…
ylglutamylthreonylisoleucylglutaminyla…
aspartylprolylisoleucyltyrosylprolylpr…
sylleucyllysylisoleucylglycylleucyliso…
nylvalylhistidylleucylseryltryptophyll…
artylglycylglycylserylprolylvalylthreo…
tamylcysteinylleucylalanyltryptophylas…
ysyllysylglutamylalanyltryptophylargin…
ylarginylaspartylvalylglutamylglutamyl…
lvalylglutamylaspartylleucylvalylgluta…
mylphenylalanylarginylvalyllysylalanyl…
alylseryllysylprolylserylalanylthreony…
cysteinylglutaminylarginylprolylaspart…
ylaspartylleucyllysylglutamylphenylala…
utamylglycylthreonylasparaginylvalylas…
soleucyllysylglycylvalylprolylphenylal…
ptophylphenylalanyllysylalanylprolylpr…
inyllysylglutamylprolylvalylleucyltyro…
araginyllysylleucylvalylvalylaspartyla…
cylvalylisoleucylprolylglutaminylseryl…
glycylleucyltyrosylthreonylisoleucylth…
inylleucylglycylthreonylalanylseryllys…
araginylvalylleucylglycylarginylprolyl…
isoleucyllysylphenylalanylglutamylsery…
methionylthreonylleucylseryltryptophyl…
ylaspartylglycylglycylseryllysylisoleu…
soleucylglutamyllysylarginylglutamylal…
tryptophylvalylhistidylvalylserylseryl…
lthreonyltyrosylthreonylisoleucylproly…
tidylglutamyltyrosylvalylphenylalanyla…
minylasparaginyllysyltyrosylglycylisol…
rtylserylglutamylprolylglutamylthreony…
ylalanylserylvalylprolylglycylalanylpr…
lserylserylvalylthreonylarginylasparag…
raginyltryptophylglutamylglutamylproly…
lserylprolylvalylthreonylglycyltyrosyl…
sylaspartylthreonylthreonylseryllysyla…
paraginylarginylaspartylprolylisoleucy…
glycylvalylseryltyrosyllysylvalylthreo…
cylserylaspartyltyrosylglutaminylpheny…
leucylasparaginylalanylalanylglycylval…
ylserylaspartylprolylalanylthreonylala…
anylprolylprolylglycylprolylprolylphen…
artyltryptophylthreonyllysylserylseryl…
hylserylprolylprolylleucyllysylasparty…
lglycyltyrosylisoleucylvalylglutamylty…
ylglutamylglutamyltryptophylglutamylly…
valylarginylglycylthreonyllysylleucylv…
lutamylglycylalanylphenylalanyltyrosyl…
lanylvalylasparaginylisoleucylalanylgl…
ycylglutamylvalylthreonylaspartylvalyl…
rtylarginylleucylvalylserylprolylaspar…
anylserylvalylarginylaspartylarginylis…
ylglycylvalylisoleucylarginylisoleucyl…
cyllysylprolylprolylprolylthreonylvaly…
onylasparaginylglutamylarginylthreonyl…
lthreonylisoleucylglutamylthreonylthre…
ethionylvalylisoleucyllysylasparaginyl…
idylglutaminylglycylvalyltyrosylseryll…
utamylalanylglycylglutamylarginyllysyl…
laspartylvalylleucylaspartylvalylproly…
lylphenylalanylleucylalanylhistidylasp…
utamylserylcysteinyllysylleucylthreony…
lutamylaspartylaspartylglycylglycylser…
ltyrosylvalylisoleucylglutamyllysylarg…
inylalanyltryptophylthreonylprolylvaly…
ylarginylglutaminylasparaginylalanylth…
oleucylglutaminylglycyllysylalanyltyro…
soleucylalanylalanylglutamylasparaginy…
lprolylphenylalanylvalylglutamylthreon…
leucylarginylglutamylprolylisoleucylth…
lylglutamylaspartylleucylglutamylvalyl…
raginylthreonylvalylthreonylleucylthre…
yllysyltyrosylaspartylglycylglycylsery…
nyltyrosylvalylleucylglutamylserylargi…
tamyllysylphenylalanylhistidyllysylval…
ginylleucylleucylserylarginyllysyltyro…
sylglutamylglycylaspartylthreonyltyros…
lanylvalylasparaginylisoleucylvalylgly…
phenylalanylcysteinylthreonyllysylprol…
partylglutamylleucylalanylprolylprolyl…
lphenylalanylarginylaspartyllysylleucy…
lglutamylalanylphenylalanylalanylleucy…
lycyllysylprolyllysylprolyllysylvalyls…
rtylglutamylalanylaspartylvalylleucylg…
nylhistidylisoleucyllysylthreonylthreo…
leucylglutamyllysylisoleucyllysylalany…
yllysyltyrosylcysteinylvalylvalylvalyl…
cylserylarginyllysylglycylphenylalanyl…
valylvalylaspartylhistidylprolylglycyl…
erylphenylalanylaspartylglutamylvalylt…
lvalylisoleucylseryltryptophyllysylpro…
ylglycylseryllysylisoleucylthreonylasp…
utamyllysyllysylglutamylvalylglycyllys…
rolylvalylthreonylserylalanylserylalan…
ylvalylseryllysylleucylleucylglutamylg…
henylalanylarginylisoleucylhistidylala…
glycylisoleucylserylaspartylprolylleuc…
ysylalanyllysylaspartylarginylphenylal…
lprolylaspartylglutaminylprolylisoleuc…
llysylaspartylserylalanylleucylvalylth…
lylhistidylaspartylglycylglycyllysylpr…
osylisoleucylleucylglutamyllysylarginy…
larginyltryptophylalanylarginylvalylth…
istidylprolyltyrosylthreonyllysylpheny…
ucylleucylglutamylglycylcysteinylgluta…
inylvalylserylalanylglutamylasparaginy…
ycylaspartylprolylserylprolylprolylser…
llysylaspartylprolylisoleucylalanyllys…
aginylprolylglutamylalanylisoleucylasp…
aginylserylvalylaspartylleucylthreonyl…
inylhistidylaspartylglycylglycylseryll…
leucylvalylglutamyltyrosylglutaminylly…
myltryptophylarginylarginylalanylaspar…
lserylcysteinylprolylglutamylthreonyll…
leucylarginylaspartylglycylglutaminylt…
nylvalylleucylalanylvalylasparaginylal…
ylprolylalanylhistidylvalylprolylgluta…
tylarginylleucylglutamylprolylprolylgl…
alanylasparaginylmethionylalanylarginy…
llysylvalylglycylaspartylthreonylleucy…
soleucyllysylglycylvalylprolylphenylal…
hyllysyllysylglutamylaspartylarginylas…
ylarginylisoleucylaspartylvalylthreony…
lutamylisoleucylarginylasparaginylalan…
cylglycylisoleucyltyrosylserylleucylth…
lalanylglycylseryllysylthreonylvalylse…
aspartyllysylprolylglycylprolylprolyla…
rylglutamylisoleucylarginyllysylaspart…
yltryptophyllysylglutamylprolylleucyla…
ylisoleucylthreonylasparaginyltyrosylv…
rtylvalylalanylserylalanylglutaminyltr…
lthreonylseryllysyllysyllysylserylhist…
leucylasparaginylglutamylglycylasparag…
anylarginylvalylalanylalanylglutamylas…
inylglycylprolylphenylalanylvalylgluta…
yllysylalanylleucylaspartylprolylleucy…
olyllysylaspartylleucylhistidylhistidy…
eonylglutamylvalylserylleucylvalyltryp…
larginylaspartylglycylglycylserylproly…
ylvalylglutamyltyrosylglutaminylglutam…
spartyltryptophylisoleucyllysylphenyla…
raginylleucylglutamylcysteinylvalylval…
taminylglycyllysylthreonyltyrosylargin…
ylglutamylasparaginylisoleucylvalylgly…
threonylthreonylisoleucylprolylisoleuc…
yllysylleucylvalylprolylprolylserylval…
eucylisoleucylglutamylglycylleucylvaly…
onylvalylarginylphenylalanylprolylalan…
lylprolylvalylprolylthreonylalanyllysy…
glycylserylglutamylisoleucyllysylthreo…
hreonylvalylglutamylthreonylaspartylas…
lleucylthreonylisoleucyllysylasparagin…
rtylthreonylglycylglutamyltyrosylgluta…
araginylalanylalanylglycylseryllysylth…
lthreonylvalylleucylaspartylvalylproly…
olylisoleucylasparaginylisoleucylleucy…
lhistidylmethionylthreonylisoleucylser…
ysylaspartylaspartylglycylglycylserylp…
ylisoleucylvalylglutamyllysylglutaminy…
ylthreonyltryptophylglycylvalylvalylse…
yllysylleucyllysylisoleucylprolylhisti…
inylglutamyltyrosylvalylphenylalanylar…
raginyllysylisoleucylglycylvalylglycyl…
onylprolylthreonylvalylalanyllysylhist…
lylserylprolylprolylglycyllysylprolylv…
hreonylglutamylasparaginylalanylalanyl…
lleucylprolyllysylserylaspartylglycylg…
ycyltyrosyltyrosylmethionylglutamylarg…
cyllysyltryptophylvalylarginylvalylasp…
lalanylaspartylleucyllysylphenylalanyl…
osylglutamylglycylasparaginylthreonylt…
lylphenylalanylalanylglutamylasparagin…
lprolylserylprolylserylserylaspartylpr…
ginylprolylisoleucyllysylprolylprolylg…
ylprolyllysylleucyllysylaspartyllysyls…
partylleucylvalyltryptophylthreonyllys…
ycylserylprolylisoleucylleucylglycylty…
taminyllysylprolylglycylthreonylalanyl…
nylisoleucylasparaginyllysylaspartylgl…
nylcysteinylalanylphenylalanylarginylv…
amylglycylasparaginylglutamyltyrosylar…
sylalanylalanylasparaginylisoleucylval…
larginylglutamylleucylalanylglutamylse…
lisoleucylleucylhistidylprolylprolylgl…
lylthreonylcysteinylarginylaspartylval…
lglycylglutaminylthreonylisoleucylargi…
llysylglycylarginylprolylglutamylproly…
lthreonyllysylglutamylglycyllysylvalyl…
nylvalylaspartylleucylisoleucylglutami…
glutamylleucylglutaminylisoleucyllysyl…
artylhistidylglycyllysyltyrosylisoleuc…
nylserylserylglycylhistidylalanylgluta…
lasparaginylvalylleucylaspartylarginyl…
ylasparaginylleucyllysylvalylthreonyla…
lasparaginylcysteinylthreonylisoleucyl…
rolylleucylaspartylasparaginylglycylgl…
sparaginylphenylalanylisoleucylvalylgl…
raginylglutaminyllysylglycyltryptophyl…
tylvalylthreonyllysylarginylleucylisol…
ucylalanylasparaginylasparaginylglutam…
valylcysteinylalanylglutamylasparaginy…
hreonylisoleucylglutamylthreonyllysylt…
soleucylasparaginylprolylisoleucylaspa…
ylglutamylasparaginylleucylhistidyliso…
lthreonylphenylalanylvalyltyrosylleucy…
laspartyltyrosylaspartylglycylglycylse…
sylhistidylvalylglutamylarginylarginyl…
tyltryptophylglutamylarginylvalylhisti…
utamylthreonylhistidyltyrosylmethionyl…
lutamylasparaginylglutaminylisoleucylt…
lylglutaminylthreonyllysylasparaginylg…
artyltryptophylvalyllysylthreonylgluta…
amylaspartylleucylglutaminyllysylproly…
ylserylglycylvalylleucylthreonylvalyll…
leucylarginylleucylglutamylalanylglycy…
lalanylprolylglutamylvalylalanyltrypto…
tylalanylthreonylaspartylleucylthreony…
lisoleucylaspartylthreonylarginylalany…
lserylleucylthreonyllysylalanyllysylar…
tyrosylvalylvalylthreonylalanylthreony…
ylphenylalanylvalylalanyltyrosylalanyl…
aspartyllysylprolylglycylprolylvalylar…
lvalylaspartylvalylserylserylaspartyla…
yltryptophylaspartylprolylprolylglutam…
inylglutamylisoleucylglutaminylasparag…
ysylcysteinylglutamylthreonyllysylargi…
eonyltyrosylserylalanylthreonylvalylle…
eonylvalylthreonylarginylleucylisoleuc…
tyrosylisoleucylphenylalanylarginylval…
ysylisoleucylglycylthreonylglycylproly…
olylvalylisoleucylalanyllysylthreonyll…
larginylprolylaspartylprolylprolylglut…
ylglutamylglutamylmethionylthreonylval…
rolylglutamyltyrosylaspartylglycylglyc…
tyrosylphenylalanylleucylglutamyllysyl…
onylarginyltryptophylvalylprolylvalyla…
prolylglutamylarginylarginylmethionyll…
lleucylprolylaspartylhistidylglutamylt…
valyllysylalanylglutamylasparaginylglu…
glutamylprolylserylleucylprolylserylar…
artylprolylisoleucylglutamylprolylprol…
inylphenylalanylarginylvalylvalylaspar…
ylisoleucylthreonylleucylglycyltryptop…
artylglycylglycylalanylprolylisoleucyl…
tamylmethionylarginylprolyllysylisoleu…
spartylglutamylglycyltryptophyllysylar…
ylalanylglutaminylleucylvalylarginylly…
lthreonylserylleucylaspartylglutamylas…
lutamylphenylalanylarginylvalylcystein…
inylvalylglycylisoleucylglycylarginylp…
mylalanylisoleucyllysylprolyllysylglut…
olylglutamylisoleucylaspartylleucylasp…
ylleucylvalylisoleucylvalylarginylalan…
inylleucylphenylalanylalanylisoleucylv…
lprolyllysylvalylthreonyltryptophylarg…
ylasparaginylvalylvalylarginyllysylgly…
ylaspartylthreonylmethionylalanylpheny…
paraginylserylthreonylarginylaspartyla…
leucylthreonylleucylvalylasparaginylpr…
valylphenylalanylvalylasparaginylvalyl…
rolylglycylprolylvalylserylaspartylleu…
onyllysylthreonylserylcysteinylhistidy…
olylglutamylasparaginylaspartylglycylg…
stidyltyrosylisoleucylvalylglutamyllys…
nyllysylthreonyltryptophylserylthreony…
syllysylthreonylserylphenylalanylhisti…
lylprolylglycylasparaginylglutamyltyro…
hreonylalanylvalylasparaginylglutamylt…
threonylaspartylvalylprolyllysylprolyl…
lleucylserylglutamylprolylaspartylprol…
lanylthreonylglutamylmethionylthreonyl…
leucylalanyltryptophylleucylprolylprol…
alanyllysylisoleucylaspartylglycyltyro…
ginylglutamylglutamylglutamylglutaminy…
hylthreonylglutamyltyrosylserylvalylva…
lylvalylthreonylglycylleucyllysylgluta…
ylalanylarginylvalylalanylalanylarginy…
erylleucylprolylarginylglutamylalanylg…
anyllysylglutamylglutaminylleucylleucy…
thionylprolylglutamylglutaminylisoleuc…
llysyllysylleucylarginylisoleucylgluta…
lysylprolylhistidylprolylthreonylcyste…
glutamylaspartylglutamylvalylvalylthre…
alylhistidyllysylalanylaspartylserylse…
leucyllysylaspartylvalylthreonylarginy…
osylserylleucylthreonylalanylglutamyla…
spartylthreonylglutaminyllysylisoleucy…
tylalanylprolylglycylprolylprolylgluta…
ylisoleucylserylaspartylisoleucylaspar…
ylleucylseryltryptophylhistidylisoleuc…
lglycylserylasparaginylisoleucylthreon…
lutamyllysylcysteinylaspartylvalylsery…
ylthreonylalanylleucylalanylserylvalyl…
arginylvalylglycyllysylleucylisoleucyl…
ylisoleucylphenylalanylarginylvalylarg…
lphenylalanylglycylisoleucylserylgluta…
ysylmethionylvalylalanylglutaminylphen…
ylprolylserylglutamylprolyllysylaspara…
lvalylasparaginyllysylaspartylcysteiny…
yptophylaspartylarginylprolylaspartyls…
isoleucylisoleucylglycyltyrosylleucyli…
larginylasparaginylserylleucylleucyltr…
aspartylthreonylleucylvalylarginylsery…
inylalanylglycylleucylvalylglutamylgly…
alanylarginylisoleucyltyrosylalanylleu…
lserylprolylprolylseryllysylprolylthre…
nylarginylmethionylprolylvalylaspartyl…
ylvalylisoleucylaspartylvalylthreonyll…
oleucyltryptophylalanylarginylprolylly…
llysylisoleucylisoleucylglycyltyrosylp…
inyllysylleucylprolylglycylaspartyllys…
paraginylthreonylalanylprolylhistidylg…
lutamylglutamyltyrosylthreonylalanylth…
ysylalanylglutaminyltyrosylglutaminylp…
anylarginylthreonylalanylvalylasparagi…
lutamylprolylserylaspartylprolylvalylt…
lasparaginylvalylprolylprolylarginylis…
ylmethionyllysylserylleucylleucylthreo…
paraginylvalylcysteinylleucylaspartyla…
llysylprolylmethionylprolylthreonylval…
glycylthreonylleucylleucyllysylprolyla…
thionylalanylmethionylglutaminylarginy…
leucylglutamylleucylphenylalanylserylv…
serylglycylaspartyltyrosylthreonylisol…
nylserylserylglycylseryllysylserylalan…
valylleucylaspartyllysylprolylglycylpr…
eucylasparaginyllysylmethionyltyrosyls…
eucylseryltryptophylglutamylprolylprol…
lserylglutamylisoleucylthreonylasparag…
sylarginylglutamylthreonylserylarginyl…
utaminylvalylserylalanylthreonylvalylp…
lserylvalylglutamyllysylleucylisoleucy…
sylglutaminylphenylalanylarginylisoleu…
yllysyltyrosylglycylvalylglycylasparty…
tamylprolylalanylisoleucylalanyllysyla…
ylprolylglycylarginylcysteinylaspartyl…
raginylisoleucylthreonyllysylaspartylh…
ryptophyllysylprolylprolylalanylaspart…
oleucylthreonylglycyltyrosylleucylleuc…
nylglutaminylalanylvalylasparaginyltry…
larginyllysylprolylisoleucylisoleucylg…
anylthreonylglycylleucylglutaminylglut…
utamylphenylalanylarginylvalylthreonyl…
ylglycylprolylglycyllysylprolylserylas…
yrosylalanylarginylaspartylprolylgluta…
lprolylalanylphenylalanylprolyllysylva…
rginylserylserylvalylserylleucylserylt…
osylaspartylglycylglycylserylprolyliso…
alylglutamylvalyllysylarginylalanylasp…
phylvalylarginylcysteinylasparaginylle…
ylglutaminyllysylthreonylarginylphenyl…
ucylmethionylglutamylaspartylthreonylg…
nylarginylvalyltyrosylalanylvalylaspar…
rylaspartylprolylserylaspartylvalylpro…
yllysylaspartylisoleucylleucylisoleucy…
histidylaspartylalanylaspartylleucylar…
ucylarginylalanylglycylvalylthreonylme…
lylvalyllysylglycylarginylprolylprolyl…
hylseryllysylprolylasparaginylvalylasp…
lisoleucylglycylleucylaspartylisoleucy…
anylaspartylthreonylphenylalanylleucyl…
valylasparaginyllysyltyrosylaspartylal…
ylthreonylleucylglutamylasparaginylser…
tyrosylthreonylisoleucylvalylvalyllysy…
lycylprolylprolylisoleucylasparaginylv…
ucylseryllysylaspartylserylalanyltyros…
olylprolylisoleucylisoleucylaspartylgl…
ucylasparaginyltyrosylvalylvalylglutam…
mylarginyllysylseryltryptophylserylthr…
ysteinylseryllysylthreonylserylphenyla…
eucylglutamylglutamylglycyllysylserylt…
ylvalylphenylalanylalanylglutamylaspar…
lglycylaspartylprolylglycylglutamylthr…
lalanylserylglutaminylthreonylprolylgl…
ysylvalylarginylserylvalylseryllysylse…
yltryptophyllysyllysylprolylhistidylse…
isoleucylisoleucylglycyltyrosylvalylva…
ylglutamylglutamylasparaginyllysyltryp…
yllysylserylleucylserylleucylglutaminy…
cylthreonylglutamylglycyllysylglutamyl…
alylserylalanylglutamylasparaginylglut…
threonylprolylserylglutamylisoleucylth…
ylaspartylvalylvalylalanylprolylaspart…
ucylprolylaspartylleucylcysteinyltyros…
nylserylasparaginylphenylalanylarginyl…
lysylglycyllysylprolylalanylprolylsery…
ylglutamylaspartylprolylleucylalanylth…
erylvalylglutamylserylserylalanylvalyl…
oleucylvalyltyrosylaspartylcysteinylgl…
cyllysyltyrosylthreonylisoleucylthreon…
glycylthreonyllysylglutamylglycylthreo…
lvalylglycyllysylprolylglycylisoleucyl…
lysylphenylalanylaspartylglutamylvalyl…
ylthreonylleucyllysyltryptophylalanylp…
cylglycylserylglutamylisoleucylthreony…
lutamyllysylarginylaspartylserylvalyla…
lvalylthreonylcysteinylalanylserylalan…
nylphenylalanylarginylvalylthreonylarg…
hionylglutamyltyrosylthreonylphenylala…
sparaginyllysyltyrosylglycylvalylglycy…
amylprolylisoleucylvalylalanylarginylh…
lylprolylaspartylalanylprolylprolylpro…
spartylvalylarginylhistidylaspartylser…
lthreonylaspartylprolyllysyllysylthreo…
threonylglycyltyrosylhistidylleucylglu…
ylasparaginylserylleucylleucyltryptoph…
lthreonylprolylisoleucylarginylmethion…
alylthreonylglycylleucylthreonylglutam…
ylphenylalanylarginylvalylmethionylala…
glycylvalylglycyllysylprolylserylleucy…
lalanylleucylaspartylprolylisoleucylas…
glutamylvalylisoleucylasparaginylisole…
valylthreonylleucylisoleucyltryptophyl…
spartylglycylglycylhistidyllysylleucyl…
glutamyllysylarginylaspartylleucylprol…
llysylalanylasparaginylhistidylvalylas…
ylalanylphenylalanylthreonylvalylthreo…
lglycyllysyltyrosylglutamylphenylalany…
asparaginylthreonylalanylglycylalanyli…
mylserylthreonylglutamylthreonylisoleu…
lutamyltyrosylglutamylalanylprolylthre…
lylthreonylisoleucyllysylaspartylglycy…
glycylaspartylthreonylisoleucylvalylle…
isoleucylleucylglycyllysylprolylleucyl…
llysylalanylglycyllysylaspartylisoleuc…
ylthreonylglutaminylisoleucylthreonyls…
lmethionylleucylthreonylisoleucyllysyl…
partylalanylglycylglutamyltyrosylthreo…
sparaginylprolylphenylalanylglycylthre…
lysylvalylthreonylvalylleucylaspartylv…
rolylvalylglutamylisoleucylserylaspara…
lanylthreonylleucylthreonyltryptophylt…
partylglycylglycylserylprolylisoleucyl…
tamyllysylarginylglutamylthreonylseryl…
ylvalylvalylserylglutamylaspartylisole…
histidylvalylalanylthreonyllysylleucyl…
lglutamyltyrosylisoleucylphenylalanyla…
nylhistidyltyrosylglycyllysylglycylglu…
amylprolylvalyllysylmethionylvalylaspa…
prolylglycylprolylprolylglutamyllysylp…
alylthreonyllysylasparaginylthreonylal…
ylarginylprolylvalylaspartylaspartylgl…
eonylglycyltyrosylhistidylvalylglutamy…
rylleucylarginyltryptophylvalylarginyl…
alylserylaspartylleucylarginylcysteiny…
aminylglutamylglycylserylthreonyltyros…
erylalanylglutamylasparaginylarginylal…
ylserylglutamylalanylserylaspartylsery…
lanylalanyltyrosylprolylprolylglycylpr…
tidylvalylthreonylaspartylthreonylthre…
lalanyltryptophylglycyllysylprolylhist…
ylglutamylisoleucylthreonylglycyltyros…
nyllysylvalylglycylaspartylglutamylala…
threonylthreonylglycylthreonylalanylle…
nylphenylalanylvalylvalylprolylasparty…
myllysyltyrosylasparaginylphenylalanyl…
lasparaginylaspartylalanylglycylvalylg…
ucylprolylaspartylvalylglutamylisoleuc…
onylalanylprolylaspartylphenylalanylgl…
eucylarginylarginylthreonylleucylvalyl…
isoleucylarginylisoleucylphenylalanylv…
ylprolylalanylprolylglutamylvalylthreo…
sparaginylisoleucylasparaginylleucylly…
nylisoleucylglutamylasparaginylthreony…
eucylleucylisoleucylisoleucylprolylglu…
osylaspartylthreonylglycyllysylphenyla…
lglutamylasparaginylprolylalanylglycyl…
lylasparaginylvalylarginylvalylleucyla…
lylleucylasparaginylleucylarginylproly…
ysylaspartylserylvalylthreonylleucylhi…
lleucylisoleucylaspartylglycylglycylse…
nyltyrosylisoleucylvalylglutamyllysyla…
lysylseryltyrosylserylthreonylalanylth…
llysylcysteinylthreonyltyrosyllysylval…
glycylcysteinylglutamyltyrosylphenylal…
ylalanylglutamylasparaginylglutamyltyr…
olylthreonylglutamylthreonylthreonylgl…
utamylalanylprolylserylprolylprolylasp…
lmethionylaspartylisoleucylthreonyllys…
yltryptophylprolyllysylprolyllysylhist…
soleucylthreonylglycyltyrosylvalylisol…
llysylglycylserylaspartylglutaminyltry…
eonylthreonylvalyllysylglycylleucylglu…
raginylleucylthreonylglutamylglycylglu…
lanylglutaminylvalylmethionylalanylval…
ylserylalanylprolylarginylglutamylsery…
sylglutamylglutaminylthreonylmethionyl…
eucylarginylglycylisoleucyltyrosylglut…
yllysylalanylglycylaspartylasparaginyl…
lprolylvalylleucylglycylarginylprolyll…
tophyllysyllysylglycylaspartylglutamin…
eonylglutaminylarginylvalylasparaginyl…
lalanylthreonylserylthreonylisoleucyll…
lglutamylcysteinylvalylarginylserylasp…
leucylthreonylalanylarginylasparaginyl…
ycylaspartylvalylisoleucylthreonylisol…
lisoleucylprolylglycylprolylprolylthre…
lalanylaspartylglutamylvalylserylseryl…
enylalanylseryltryptophylaspartylproly…
lycylglycylvalylprolylisoleucylserylas…
ethionylarginylglutaminylthreonylaspar…
alylglutamylleucylalanylthreonylthreon…
onyltyrosyllysylalanylthreonylarginyll…
utamyltyrosylglutaminylphenylalanylarg…
aginylarginyltyrosylglycylvalylglycylp…
anyltryptophylisoleucylvalylalanylaspa…
ylvalylprolylglycylprolylprolylglycylt…
lalanylvalylthreonyllysylaspartylseryl…
tophylhistidylglutamylprolylleucylsery…
leucylleucylglycyltyrosylhistidylvalyl…
asparaginylglycylisoleucylleucyltrypto…
ylalanylleucylvalylprolylglycylasparag…
serylglycylleucylthreonylaspartylglycy…
ylalanylarginylvalylisoleucylalanylglu…
yllysylseryllysylprolylseryllysylproly…
alanylleucylaspartylprolylisoleucylasp…
alylprolylleucylasparaginylisoleucylth…
hreonylleucyllysyltryptophylalanyllysy…
lglycylphenylalanyllysylisoleucylthreo…
yllysylarginylaspartylleucylprolylaspa…
llysylalanylasparaginylphenylalanylser…
lasparaginylglutamylphenylalanylthreon…
tamylaspartylalanylalanyltyrosylglutam…
alanyllysylasparaginylalanylalanylglyc…
erylglutamylprolylserylaspartylalanyli…
artylaspartylvalylglutamylalanylprolyl…
yllysylphenylalanyllysylaspartylthreon…
ycylglutamylalanylphenylalanylarginyll…
ylglycylarginylprolylprolylprolylthreo…
lysylaspartylglycyllysylglutamylleucyl…
ucylglutamylisoleucyllysylisoleucylala…
lasparaginylleucylvalylasparaginyllysy…
laspartylserylglycylalanyltyrosylthreo…
raginylprolylglycylglycylphenylalanyla…
anylasparaginylvalyllysylvalylleucylas…
ylglutamylglycylprolylleucylalanylvaly…
glutamyllysylcysteinylvalylleucylseryl…
eucylaspartylaspartylglycylglycylalany…
sylisoleucylvalylglutaminyllysylarginy…
alanyltryptophylthreonylasparaginylval…
lvalylthreonyllysylleucyllysylvalylthr…
paraginylglutamyltyrosylisoleucylpheny…
alylasparaginyllysyltyrosylglycylvalyl…
erylglutamylprolylvalylleucylalanylval…
lylprolylaspartylprolylprolyllysylaspa…
hreonylisoleucylthreonyllysylaspartyls…
ptophylglycylhistidylprolylaspartylser…
isoleucylisoleucylasparaginyltyrosylis…
spartyllysylalanylglycylglutaminylargi…
lasparaginyllysyllysylthreonylleucylth…
ysylvalylserylglycylleucylthreonylglut…
utamylphenylalanylarginylisoleucylmeth…
lalanylglycylisoleucylserylalanylproly…
ylalanyltyrosyllysylalanylcysteinylasp…
prolylglycylprolylprolylglycylasparagi…
threonylserylarginylserylserylisoleucy…
raginyllysylprolylisoleucyltyrosylaspa…
cylthreonylglycyltyrosylmethionylvalyl…
glutamylglutamylaspartylglutamyltrypto…
lprolylprolylalanylglycylleucyllysylal…
leucylthreonylglycylleucylthreonylglut…
rosyllysylisoleucylarginylisoleucyltyr…
glutamylglycylleucylglycylglutamylprol…
onylprolyllysylalanylglutamylaspartyla…
utamylisoleucylglutamylleucylaspartyla…
lvalylthreonylisoleucylarginylalanylcy…
ylleucylphenylalanylvalylprolylisoleuc…
rolylglutamylvalyllysyltryptophylalany…
mylserylleucylaspartyllysylalanylseryl…
ryltyrosylthreonylleucylleucylisoleucy…
inylarginylphenylalanylaspartylserylgl…
onylvalylglutamylasparaginylserylseryl…
anylvalylasparaginylvalylarginylvalyll…
olylprolylglutaminylaspartylleucyllysy…
ylthreonylserylvalylthreonylleucylthre…
eucylleucylaspartylglycylglycylserylly…
isoleucylvalylglutamyllysylarginylglut…
tyrosylserylthreonylvalylalanylthreony…
hreonylseryltryptophyllysylvalylaspart…
lglycylcysteinylseryltyrosyltyrosylphe…
utamylasparaginylglutamyltyrosylglycyl…
utamylthreonylalanylglutamylserylvalyl…
ylleucylprolylprolylglycyllysylisoleuc…
lylthreonylarginylasparaginylserylvaly…
lysylprolylglutamylhistidylaspartylgly…
lglycyltyrosylisoleucylvalylglutamylme…
lserylaspartyllysyltryptophylalanylthr…
sylvalylthreonylglutamylalanylthreonyl…
cylglutaminylglycylglutamylglutamyltyr…
rylalanylglutaminylasparaginylglutamyl…
olylarginylglutaminylleucylserylvalylp…
tylleucylvalylisoleucylprolylprolylala…
nylalanylasparaginylthreonylphenylalan…
utamylaspartylleucyllysylvalylaspartyl…
cylarginylprolylthreonylprolylalanylva…
spartylasparaginylvalylprolylleucyllys…
valylasparaginylalanylglutamylserylthr…
serylleucylleucylthreonylisoleucyllysy…
amylaspartylvalylglycylhistidyltyrosyl…
ginylserylalanylglycylglutamylalanylis…
ginylvalylisoleucylvalylleucylaspartyl…
ylglycylprolylvalyllysylmethionylaspar…
tylserylisoleucylthreonylleucylseryltr…
sylaspartylglycylglycylserylserylisole…
oleucylvalylglutamyllysylarginylaspart…
onyltryptophylglutaminylisoleucylvalyl…
ylthreonylthreonylisoleucyllysylalanyl…
glycylcysteinylglutamyltyrosylglutamin…
lalanylglutamylasparaginylarginyltyros…
ucylasparaginylserylglutamylprolylthre…
lylphenylalanyllysylvalylprolylglycylp…
lvalylthreonylleucylserylserylarginyla…
lutaminyltryptophylasparaginylglutamyl…
lycylserylarginylvalylisoleucylglycylt…
lysylglutamylarginylasparaginylserylis…
ucylasparaginyllysylthreonylprolylisol…
henylalanyllysylthreonylthreonylglycyl…
utamyltyrosylglutamylphenylalanylargin…
ylisoleucylvalylglycylisoleucylglycyll…
mylcysteinyltyrosylvalylalanylarginyla…
lprolylglycylarginylprolylglutamylalan…
ginylasparaginylserylvalylthreonylleuc…
lylthreonyltyrosylaspartylglycylglycyl…
rosylisoleucylvalylglutamyllysyllysylg…
ginyltryptophylmethionyllysylalanylser…
oleucylisoleucylaspartylthreonylhistid…
glycylleucylvalylglutamylaspartylhisti…
ylarginylvalylisoleucylalanylarginylas…
nylalanylserylglutamylprolylserylgluta…
ylthreonylalanylarginylaspartylglutamy…
oleucylserylmethionylaspartylprolyllys…
ucylvalylvalylhistidylalanylglycylglut…
rtylalanylaspartylisoleucyltyrosylglyc…
lisoleucylglutaminyltryptophylisoleucy…
mylleucylserylasparaginylthreonylalany…
lserylthreonylaspartylphenylalanylalan…
laspartylalanylvalylarginylvalylaspart…
eucylleucyllysylalanyllysylasparaginyl…
ylvalylthreonylvalylasparaginylvalylly…
glycylprolylprolylglutamylglycylprolyl…
threonylalanylglutamyllysylcysteinylth…
olylprolylleucylglutaminylaspartylglyc…
ucylasparaginyltyrosylisoleucylvalylgl…
lserylarginylleucylvalyltryptophylthre…
inylvalylglutaminylthreonylleucylseryl…
cylleucylglutamylglycylasparaginylglut…
nylisoleucylmethionylalanylvalylaspara…
lutamylprolylleucylglutamylserylglutam…
ginylprolylphenylalanylvalylvalylproly…
lylglutamylvalylthreonylthreonylvalylt…
soleucylvalylvalyltryptophylglutamylar…
lglycylserylglutamylisoleucylleucylgly…
rginylaspartyllysylglutamylglycylisole…
lcysteinylhistidyllysylarginylleucylis…
eucylarginylvalylthreonylglycylleucyli…
aspartyltyrosylglutamylphenylalanylarg…
inylalanylalanylglycylleucylserylgluta…
yltyrosylglutaminyllysylalanylcysteiny…
lprolylglycylprolylprolylasparaginylas…
spartylisoleucylthreonylarginylserylse…
tophylseryllysylprolylisoleucyltyrosyl…
ylisoleucylglutaminylglycyltyrosylisol…
artylvalylasparaginylvalylglycylglutam…
nylthreonylprolylprolylthreonylglycyli…
araginylisoleucylglutamylvalylglutamyl…
dylglutamyltyrosylasparaginylphenylala…
soleucylasparaginyllysylalanylglycylva…
rtylvalylprolylglycylprolylisoleucylis…
ucylglutamylalanylprolylaspartylisoleu…
amylleucylarginyllysylisoleucylisoleuc…
glycylglycylserylleucylarginylleucylph…
glycylarginylprolylthreonylprolylgluta…
alylaspartylglycylglutamylisoleucylarg…
oleucylaspartylvalylthreonylserylseryl…
lleucylaspartylasparaginylvalylasparag…
yllysyltyrosylthreonylleucylthreonylle…
ycylthreonyllysylserylalanylphenylalan…
cylaspartylthreonylprolylserylprolylpr…
lthreonylglutamylisoleucylthreonyllysy…
reonyltryptophylglutamylprolylprolylle…
lysylisoleucyllysylasparaginyltyrosyli…
utamylalanylthreonylarginyllysylserylt…
lasparaginylcysteinylhistidyllysylaspa…
laspartylglutaminylleucylglutaminylglu…
osylphenylalanylarginylvalylthreonylal…
sylglycylisoleucylglycylleucylprolylal…
lprolylisoleucyllysylvalylalanylglutam…
glycyllysylisoleucylthreonylvalylaspar…
raginylserylvalylserylleucylseryltrypt…
tidylaspartylglycylglycylseryllysyliso…
leucylvalylglutamylmethionylglutaminyl…
yltryptophylserylglutamylcysteinylalan…
minylalanylvalylisoleucylthreonylaspar…
lglutamylglutamyltyrosylleucylphenylal…
araginylglutamyllysylglycylarginylsery…
anylvalylprolylisoleucylvalylalanyllys…
mylprolylaspartylvalyllysylprolylalany…
valylglutaminylvalylglycylglutaminylas…
alylprolylisoleucylserylglycylarginylp…
reonyltryptophylthreonyllysylaspartylg…
nylthreonylthreonylarginylisoleucylasp…
eucylaspartylleucylthreonylthreonylleu…
nylhistidyllysylaspartylaspartylglycyl…
cylthreonylvalylalanylasparaginylvalyl…
lanylserylisoleucylglutamylisoleucylva…
laspartylprolylprolyllysylglycylprolyl…
tylvalylserylalanylglutamylserylisoleu…
araginylprolylprolylleucyltyrosylthreo…
soleucylthreonylasparaginyltyrosylisol…
artylthreonylthreonylthreonylthreonylv…
ylalanylthreonylvalylalanylarginylthre…
llysylleucyllysylthreonylglycylthreony…
nylarginylisoleucylphenylalanylalanylg…
cylglutaminylserylphenylalanylalanylle…
eucylvalylalanylglutaminyltyrosylproly…
olylprolylglycylthreonylprolylphenylal…
ryllysylaspartylserylmethionylvalyliso…
lutamylprolylvalylasparaginylasparagin…
ucylglycyltyrosylhistidylleucylglutamy…
inylserylisoleucylleucyltryptophylthre…
nylisoleucylisoleucylhistidylaspartylt…
lanylglutaminylasparaginylleucylglutam…
rosylglutamylphenylalanylarginylvalylt…
eucylvalylglycylvalylglycyllysylalanyl…
ysteinyltyrosylvalylalanylarginylaspar…
lylglycylthreonylprolylglutamylprolyli…
sparaginylglutamylisoleucylthreonylleu…
lprolylvalyltyrosylaspartylglycylglycy…
cyltyrosylisoleucylvalylglutamyllysyla…
lycylarginyltryptophylmethionyllysylal…
ginylvalylisoleucylglutamylthreonylglu…
ylglycylleucylthreonylglutamylaspartyl…
nylalanylarginylvalylisoleucylalanylly…
nylisoleucylseryllysylprolylserylaspar…
ylthreonylalanyllysylaspartylglutamylv…
eucylserylmethionylaspartylprolyllysyl…
isoleucylvalylvalylasparaginylalanylgl…
inylleucylglutamylalanylaspartylvalylh…
lthreonylisoleucylglutamyltryptophylle…
mylisoleucylglutamylglutamylserylalany…
ysylasparaginylthreonylaspartylphenyla…
ylvalyllysylaspartylalanylisoleucylarg…
utaminyltyrosylisoleucylleucylarginyla…
cylseryllysylserylphenylalanylprolylva…
aspartylarginylprolylglycylprolylproly…
lvalylthreonylglycylvalylthreonylseryl…
reonyltryptophylserylprolylprolylleucy…
laspartylisoleucylserylhistidyltyrosyl…
mylthreonylserylarginylleucylalanyltry…
lglutamylvalylvalylthreonylasparaginyl…
eucylleucylglutamylglycylasparaginylgl…
ylisoleucylmethionylalanylvalylasparag…
utamylprolylleucylglutamylserylalanylp…
aginylprolylphenylalanylvalylleucylpro…
ylglutamylvalylthreonylasparaginylisol…
nylthreonylvalylcysteinyltryptophylasp…
spartylglycylglycylserylglutamylisoleu…
alylglutamyllysylarginylaspartylarginy…
hylisoleucyllysylcysteinylasparaginyll…
aspartylleucylarginylleucylarginylvaly…
ylaspartylhistidylglutamyltyrosylgluta…
nylglutamylasparaginylalanylalanylglyc…
lylalanylthreonylvalyltyrosyltyrosylly…
ylphenylalanyllysylprolylglycylprolylp…
dylisoleucylvalylaspartylthreonylthreo…
reonylleucylalanyltryptophylglycyllysy…
ylglycylserylglutamylisoleucylleucylgl…
cylcysteinyllysylalanylaspartylglutamy…
ylisoleucylvalylthreonylprolylglutamin…
hreonylarginylphenylalanylglutamylisol…
ylhistidylglutaminylglutamyltyrosyllys…
nylleucylasparaginyllysylvalylglycylle…
ylvalylprolylglycylthreonylvalyllysylp…
tamylalanylprolylglutamylleucylasparty…
rginyllysylglycylisoleucylvalylvalylar…
rginylisoleucylhistidylisoleucylprolyl…
lmethionylprolylglutamylisoleucylthreo…
utamylglycylglutamylphenylalanylthreon…
ucylglutamyllysylglycylvalylasparaginy…
ylisoleucylaspartylasparaginylcysteiny…
alanylglycyllysyltyrosylisoleucylleucy…
lserylglycylseryllysylserylalanylpheny…
leucylaspartylthreonylprolylglycylprol…
alanylvalyllysylglutamylvalylarginylly…
eucylvalyltryptophylglutamylprolylprol…
lycylalanyllysylvalyllysylasparaginylt…
ginylglutamylserylthreonylarginyllysyl…
serylseryllysylcysteinylseryllysylthre…
amylasparaginylleucylthreonylglutamylg…
henylalanylarginylvalylmethionylalanyl…
anylglycylvalylglycylvalylprolylvalylg…
alyllysylalanylalanylglutamylprolylpro…
lthreonylleucylthreonylaspartylvalylse…
ylleucylmethionyltryptophylglutamyllys…
cylglycylserylarginylvalylleucylglycyl…
lutaminylprolyllysylglycylthreonylglut…
lylalanylglutamylseryllysylvalylcystei…
nylglycylleucylserylserylglycylglutami…
lanylarginylvalyllysylalanyltyrosylasp…
ylaspartylprolylarginylvalylleucylglyc…
sylaspartylleucylthreonylisoleucylglut…
rolylphenylalanylasparaginylthreonylty…
glycylglutamylaspartylleucyllysylisole…
leucylglycylarginylprolylarginylprolyl…
valyllysylaspartylglycylglutamylprolyl…
ylarginylvalylasparaginylvalylglutamyl…
threonylvalylleucylhistidylisoleucylly…
partylaspartylphenylalanylglycyllysylt…
reonylasparaginylserylalanylglycylthre…
ylleucylserylvalylisoleucylvalylleucyl…
ylvalylglycylprolylvalylarginylphenyla…
ylaspartylphenylalanylvalylvalylisoleu…
lylalanyltyrosylthreonylglycylglycylcy…
raginyltyrosylisoleucylvalylglutamylly…
hreonylthreonylthreonyltryptophylhisti…
lvalylalanylarginylthreonylthreonyliso…
ucyllysylthreonylglycylthreonylglutamy…
ylisoleucylphenylalanylalanylglutamyla…
serylalanylprolylleucylaspartylserylly…
nyltyrosylprolylphenylalanyllysylgluta…
reonylprolylphenylalanylvalylthreonyls…
aminylmethionylleucylvalylglutaminyltr…
asparaginylaspartylglycylglycylthreony…
ylhistidylleucylglutamylglutaminyllysy…
ucylleucyltryptophylvalyllysylleucylas…
ylglutaminylaspartylthreonyllysylpheny…
eucylaspartylglutamylglycylleucylgluta…
valylserylalanylglutamylasparaginyliso…
ylprolylseryllysylvalylserylglutamylcy…
ylaspartylprolylcysteinylaspartylproly…
lanylisoleucylvalylisoleucylthreonylar…
eonylleucyllysyltryptophyllysyllysylpr…
ylseryllysylisoleucylthreonylglycyltyr…
laspartylleucylprolylaspartylglycylarg…
erylphenylalanylthreonylasparaginylval…
nylalanylthreonylvalylserylglycylleucy…
inyltyrosylglutamylphenylalanylarginyl…
nylalanylalanylglycylasparaginylphenyl…
tylserylserylglycylalanylisoleucylthre…
oleucylaspartylalanylprolylasparaginyl…
ltyrosyllysylaspartylvalylisoleucylval…
threonylphenylalanylvalylleucylglutamy…
yllysylprolylisoleucylprolylaspartylva…
lglycyllysylglutamylleucylglutamylglut…
ionylglutamylisoleucyllysylserylthreon…
hreonylleucylvalylvalyllysylaspartylcy…
rtylglycylglycylglutaminyltyrosylisole…
ylvalylglycylglycylthreonyllysylseryli…
llysylvalylleucylaspartylarginylprolyl…
ylleucyllysylvalylthreonylglycylvalylt…
tyrosylleucylalanyltryptophylasparagin…
tylglycylglycylalanylasparaginylisoleu…
leucylglutamyllysylarginylglutamylthre…
ylthreonylglutaminylvalylserylthreonyl…
asparaginyltyrosyllysylvalylthreonylly…
nylglutamyltyrosylisoleucylphenylalany…
paraginyllysyltyrosylglycylisoleucylgl…
ylglycylprolylvalylthreonylalanylcyste…
olylprolylglycylprolylprolylserylthreo…
oleucylthreonyllysylaspartylserylmethi…
nylarginylprolylvalylaspartylaspartylg…
lglutamylglycyltyrosylisoleucylleucylg…
tamylglycylvalylarginyltryptophylthreo…
sylthreonylleucylthreonylaspartylleucy…
lycylleucylthreonylglutamylglycylhisti…
arginylvalylalanylalanylglutamylaspara…
lutamylprolylserylglutamylprolylserylv…
lcysteinylaspartylalanylleucyltyrosylp…
sparaginylprolyllysylvalylthreonylaspa…
alylserylleucylalanyltryptophylserylly…
ycylglycylalanylprolylvalyllysylglycyl…
glutamylalanylalanylalanylaspartylglut…
inylthreonylprolylprolylthreonylglycyl…
ylphenylalanylthreonylvalylthreonyllys…
eonylglutamyltyrosylasparaginylphenyla…
lisoleucylasparaginylserylglutamylglyc…
reonylleucylprolylglycylserylvalylvaly…
leucylglutamylprolylprolylglutamylisol…
partylleucylarginyllysylvalylvalylvaly…
onylleucylarginylleucylphenylalanylval…
ylprolylglutamylprolylglutamylvalyllys…
amylglycylisoleucylleucylthreonylaspar…
glutamylvalylthreonylserylserylphenyla…
oleucylaspartylasparaginylvalylthreony…
ycylarginyltyrosylasparaginylleucylthr…
aginylserylglycylseryllysylthreonylala…
larginylvalylleucylaspartylserylprolyl…
ucylthreonylisoleucylarginylglutamylva…
onylleucylseryltryptophylglutamylproly…
lglycylalanyllysylisoleucylthreonylasp…
yllysylarginylglutamylthreonylthreonyl…
onylisoleucylthreonylasparaginylaspara…
threonylphenylalanylarginylisoleucylgl…
utamylglycylcysteinylseryltyrosyltyros…
nylserylasparaginylglutamyltyrosylglyc…
glutamylthreonylthreonylglutamylprolyl…
rolylleucylprolylprolylglycylarginylva…
threonylarginylasparaginylthreonylalan…
lutamyllysylprolylglutamylserylasparty…
eonylglycyltyrosylvalylvalylglutamylme…
lserylglutamyllysyltryptophylserylthre…
llysylthreonylleucylglutamylalanylthre…
nylalanylglycylglutamylglutamyltyrosyl…
alanylvalylasparaginylglutamyllysylgly…
lglutaminylleucylglycylvalylprolylvaly…
eucylglutamylisoleucyllysylprolylseryl…
ylhistidylthreonylphenylalanylasparagi…
lutaminylleucyllysylisoleucylaspartylv…
ginylprolylglutaminylalanylthreonylval…
aspartylglycylglutaminylthreonylleucyl…
lvalylasparaginylvalylserylserylseryll…
lserylisoleucyllysylglutamylalanylsery…
reonyltyrosylglutamylleucylcysteinylva…
lserylisoleucylthreonylvalylprolylisol…
lleucylaspartylarginylprolylglycylprol…
lisoleucylaspartylglutamylvalylserylcy…
ylisoleucylseryltryptophylasparaginylp…
lycylglycylcysteinylglutaminylisoleucy…
lylglutamyllysyllysylglutamylthreonylt…
hylhistidylisoleucylvalylserylglutamin…
erylisoleucyllysylisoleucylvalylarginy…
lutamyltyrosylglutaminylphenylalanylar…
paraginylarginyltyrosylglycyllysylsery…
lalanylvalylvalylalanylglutamyltyrosyl…
glycylprolylprolylglycylthreonylprolyl…
yllysylserylthreonylmethionylleucylval…
prolylvalylasparaginylaspartylglycylgl…
ltyrosylhistidylleucylglutamyltyrosyll…
cylleucyltryptophylseryllysylalanylasp…
ylalanylaspartylthreonylglutaminylvaly…
lglutamylglycylleucylmethionyltyrosylg…
anylglutamylasparaginylisoleucylalanyl…
seryllysylserylcysteinylglutamylprolyl…
lylcysteinylaspartylprolylprolylglycyl…
ylasparaginylisoleucylthreonylarginyll…
ophylseryllysylprolylhistidyltyrosylas…
cylthreonylglycyltyrosylisoleucylvalyl…
lprolylaspartylglycylarginyltryptophyl…
sylthreonylasparaginylisoleucylglutami…
nylglutamylvalylthreonylglutamylleucyl…
rginyltyrosylglutamylphenylalanylargin…
araginylalanylalanylaspartylserylvalyl…
ylthreonylglycylprolylisoleucylisoleuc…
utamylprolylprolylarginylvalylmethiony…
lanylarginylaspartylvalylisoleucylvaly…
lleucyllysylisoleucylasparaginylalanyl…
lprolylleucylprolylvalylisoleucylseryl…
isoleucylglutamylisoleucylglutamylglut…
tamylisoleucylisoleucylserylthreonylas…
ucylleucylthreonylvalyllysylaspartylcy…
tylthreonylglycylglutaminyltyrosylvaly…
ylvalylalanylglycylthreonylarginylsery…
yllysylvalylleucylaspartyllysylprolylg…
leucylglutamylisoleucylasparaginylglyc…
cysteinylserylleucylseryltryptophylgly…
spartylglycylglycylalanylaspartylisole…
rginyllysyllysylarginylglutamylthreony…
lthreonylisoleucylcysteinylglutamylgly…
lthreonylserylcysteinyllysylvalylthreo…
raginylglutamyltyrosylisoleucylphenyla…
lasparaginyllysyltyrosylglycylvalylgly…
lvalylalanylisoleucyllysylalanylleucyl…
alylprolylserylprolylprolylthreonylser…
rylvalylthreonyllysylglutamylserylmeth…
hylserylarginylprolylglutamylserylaspa…
cylserylglycyltyrosylisoleucylisoleucy…
lasparaginylserylleucylarginyltryptoph…
lysylprolylvalyltyrosylaspartylleucyla…
leucylarginylglutamylglycylcysteinylgl…
valyltyrosylalanylglutamylasparaginyla…
rolylserylglutamylthreonylserylprolyll…
aspartylprolylvalylphenylalanylleucylp…
lyllysylisoleucylvalylaspartylserylgly…
reonylisoleucylalanyltryptophylvalylly…
glycylglycylalanylprolylisoleucylthreo…
yltyrosyllysyllysylserylaspartylaspart…
reonylserylisoleucylglutaminylserylleu…
osylthreonylisoleucylserylglycylleucyl…
ltyrosylvalylphenylalanylarginylvalyll…
glycylalanylserylaspartylprolylserylas…
minylisoleucylalanyllysylglutamylargin…
cylphenylalanylaspartylisoleucylaspart…
lthreonylleucylisoleucylvalyllysylalan…
onylmethionylthreonylvalylprolylphenyl…
ylprolylasparaginylvalylleucyltryptoph…
spartylleucylarginylthreonylarginylala…
onylaspartylserylarginylthreonylseryll…
aginylalanylasparaginylarginylasparagi…
hreonylleucylthreonylisoleucylglutamin…
alanylserylleucylthreonylleucylvalylva…
prolylglycylprolylprolylthreonylaspara…
ylaspartylvalylthreonyllysylglutamylse…
aspartylvalylprolylglutamylasparaginyl…
yllysylasparaginyltyrosylhistidylisole…
nylseryllysyllysylalanyltryptophylvaly…
aginylcysteinylasparaginylarginylleucy…
raginylleucylglutaminylglutamylglycyla…
lanylarginylvalylserylglycylglutamylas…
valylglycylisoleucylprolylalanylglutam…
ysylisoleucylthreonylglutamyllysylprol…
cylglycylvalylthreonylserylisoleucylse…
ylthreonyltryptophylleucyllysylprolylg…
serylarginylisoleucylvalylhistidyltyro…
utamyllysylglycylglutaminyllysylaspara…
lanylvalylalanyllysylserylthreonylhist…
ucylarginylglutamylasparaginylserylglu…
larginylvalylphenylalanylalanylglutamy…
eucylserylaspartylprolylarginylglutamy…
lisoleucyllysylglutamylglutaminylleucy…
cylaspartylmethionyllysylasparaginylph…
ylvalyltyrosylvalylarginylalanylglycyl…
artylisoleucylprolylisoleucylserylglyc…
threonylleucylserylarginylaspartylglyc…
nylmethionylarginylphenylalanylasparag…
ylalanylglutamylasparaginylleucylthreo…
lutamylserylvalylthreonylalanylasparty…
isoleucylthreonylalanylalanylasparagin…
ysylalanylphenylalanylisoleucylasparag…
ylarginylprolylglycylprolylprolylthreo…
erylaspartylisoleucylthreonylglutamylg…
ltryptophylglutamylprolylprolyllysylty…
minylvalylthreonylasparaginyltyrosylis…
amylthreonylserylthreonylalanylvalyltr…
lanylthreonylvalylalanylarginylthreony…
nyllysylleucylthreonylthreonylglycylgl…
ylalanylarginylisoleucyllysylalanylglu…
glycylisoleucylserylaspartylhistidylis…
valylthreonylvalyllysylleucylprolyltyr…
lylprolylserylthreonylprolyltryptophyl…
ylarginylglutamylserylisoleucylthreony…
mylprolylvalylserylasparaginylglycylgl…
sylhistidylleucylglutamylmethionyllysy…
leucylleucyltryptophylglutaminyllysyla…
leucylarginylthreonylthreonylhistidylp…
ylisoleucylserylalanylglycylleucylisol…
inylvalyltyrosylalanylglutamylasparagi…
ylprolylserylhistidylprolylserylglutam…
spartylalanylcysteinylglutamylprolylpr…
soleucylthreonylaspartylisoleucylseryl…
ylseryltryptophylglutaminylglutaminylp…
ylglycylseryllysylisoleucylthreonylgly…
inylarginylaspartylleucylprolylasparty…
ylalanylserylphenylalanylthreonylaspar…
glutaminylphenylalanylthreonylisoleucy…
lasparaginylserylglutaminyltyrosylglut…
lanylalanylarginylasparaginylalanylval…
nylprolylserylglutamylvalylvalylglycyl…
leucylaspartylseryltyrosylglycylglycyl…
rolylleucylglutamyltyrosylthreonylglut…
anylglycylthreonylserylvalyllysylleucy…
lycyllysylprolylalanylprolylthreonylis…
ylaspartylaspartyllysylglutamylleucylg…
eucylvalylcysteinylvalylglutamylaspara…
alanylserylisoleucylleucylisoleucyllys…
ylasparaginylserylglycylcysteinyltyros…
sparaginylalanylmethionylalanylserylal…
inylvalylglutaminylisoleucylleucylaspa…
ycylglycylprolylisoleucylglutamylpheny…
anylglutamyllysylisoleucylthreonylleuc…
ylalanylaspartylaspartylglycylglycylal…
yrosylisoleucylvalylglutamyllysylargin…
valyltryptophylserylmethionylvalylsery…
amylcysteinylisoleucylisoleucylthreony…
eucyllysylglycylasparaginylglutamyltyr…
ylarginylalanylvalylasparaginyllysylty…
rolylleucylglutamylserylaspartylserylv…
ylphenylalanylvalylthreonylprolylglycy…
lutamylvalylthreonyllysylisoleucylthre…
hreonylvalylvalyltryptophylserylarginy…
lglycylserylaspartylisoleucylserylglyc…
lysylarginylaspartyllysyllysylserylleu…
lvalylleucyllysylglutamylthreonylisole…
lutaminyllysylvalylthreonylglycylleucy…
partyltyrosylglutaminyltyrosylarginylv…
alanylalanylglycylglutaminylglycylprol…
rylglutamylphenylalanyltyrosyllysylala…
artylprolylprolylglycylprolylprolylala…
anylaspartylserylthreonyllysylserylser…
tophylseryllysylprolylvalyltyrosylaspa…
eonylglycyltyrosylvalylvalylglutamylis…
mylglutamylglutamylglutamyltryptophylt…
sylglycylglutamylvalylarginylthreonylt…
ylasparaginylleucyllysylprolylglycylva…
lanylarginylvalylserylalanylvalylaspar…
ylglycylglutamylprolylisoleucylglutamy…
valylglutaminylalanyllysylaspartylisol…
amylisoleucylaspartylleucylaspartylval…
alylisoleucylalanyllysylalanylglycylgl…
eucylisoleucylprolylphenylalanyllysylg…
nylvalylthreonyltryptophylarginyllysyl…
cylglycylserylaspartylalanylarginyltyr…
ylthreonylaspartylserylserylserylleucy…
minylvalylthreonylarginylasparaginylas…
leucylleucylthreonylisoleucylglutamyla…
prolyllysylserylserylthreonylvalylsery…
nylprolylalanylalanylcysteinylglutamin…
stidylvalylserylarginylglycylthreonylv…
spartylprolylprolylleucylisoleucylaspa…
lisoleucylasparaginyltyrosylvalylisole…
nylthreonyllysylarginylthreonyltryptop…
lcysteinylserylserylthreonylserylpheny…
leucylserylglutamyllysylthreonylprolyl…
larginylvalylleucylalanylglutamylaspar…
cylglycylglutamylprolylcysteinylglutam…
yllysylalanylalanylglutamylvalylprolyl…
lleucylserylmethionyllysylaspartylsery…
leucylleucylseryltryptophylthreonyllys…
lglycylglycylserylvalylisoleucylthreon…
arginyllysylglycyllysylglycylglutamylg…
tidylalanylglycylisoleucylseryllysylth…
tamylvalylserylglutaminylleucyllysylgl…
tamylphenylalanylarginylvalylphenylala…
sylglycylleucylserylaspartylprolylvaly…
ucylthreonylvalyllysylglutamylleucylis…
mylvalylaspartylleucylserylaspartyliso…
alylthreonylvalylarginylisoleucylglycy…
ucylglutamylleucylprolyltyrosyllysylgl…
eucylseryltryptophylleucyllysylasparty…
mylserylglutamylphenylalanylvalylargin…
tamylasparaginyllysylisoleucylthreonyl…
lalanyllysyllysylglutamylhistidylglycy…
leucylleucylaspartylasparaginylalanylv…
valylprolylisoleucylthreonylvalylisole…
lseryllysylprolyllysylglycylprolylisol…
tamylisoleucyllysylalanylaspartylseryl…
aspartylvalylprolylglutamylaspartylasp…
soleucylthreonylcysteinyltyrosylseryli…
lthreonylserylglutaminylthreonylaspara…
ysteinylserylserylvalylalanylarginylth…
lprolylasparaginylleucylvalyllysylaspa…
phenylalanylarginylvalylarginylalanylg…
cylvalylserylglutaminylprolylleucylval…
alanyllysylhistidylglutaminylphenylala…
ylprolylglycyllysylprolylvalylisoleucy…
ylaspartylglycylmethionylserylleucylth…
lvalyltyrosylaspartylglycylglycylseryl…
anylhistidylvalylglutamyllysyllysylglu…
ylleucyltryptophylglutaminyllysylvalyl…
ucylserylglycylarginylglutamyltyrosyla…
ylglutamylglycylleucylaspartyltyrosylg…
rosylalanylglutamylasparaginylserylala…
laspartylprolylseryllysylphenylalanylt…
valylaspartylprolylprolylglycylthreony…
rtylvalylthreonylarginylglutamylthreon…
ophylasparaginylprolylprolylleucylargi…
oleucylvalylglycyltyrosylserylisoleucy…
ylasparaginylglutamylarginyltryptophyl…
nylalanylthreonylaspartylvalylserylglu…
onylvalylthreonylglycylleucylserylprol…
mylphenylalanylarginylisoleucylisoleuc…
ylglycylthreonylisoleucylserylprolylpr…
isoleucylisoleucylmethionylthreonylarg…
lprolylprolylisoleucylvalylglutamylphe…
lphenylalanylaspartylglycylleucylisole…
ylserylleucylarginylisoleucyllysylalan…
lprolylvalylprolylarginylvalylthreonyl…
glycylvalylglutamylisoleucylglutamylly…
onylglutamylisoleucylthreonylasparagin…
ylleucylphenylalanylvalylarginylaspart…
idylarginylglycylvalyltyrosylthreonylv…
lanylserylglycylserylalanyllysylalanyl…
ylglutaminylaspartylthreonylprolylglyc…
cylarginylphenylalanylthreonylasparagi…
ysylmethionylthreonylleucyltryptophylt…
asparaginylaspartylglycylcysteinylalan…
rosylisoleucylisoleucylglutamyllysylar…
ucylalanyltryptophylalanylleucylisoleu…
utamylalanylglutaminylseryltyrosylthre…
ucylasparaginylglycylasparaginylglutam…
nylvalylserylalanylvalylasparaginyllys…
nylprolylleucylaspartylserylaspartylpr…
ucylglutaminyltyrosylthreonylvalylprol…
ylprolylglutamylprolylserylasparaginyl…
erylisoleucylthreonylleucylthreonyltry…
erylaspartylglycylglycylserylglutamyli…
isoleucylleucylglutamylarginylarginylg…
yltryptophylvalyllysylvalylisoleucylse…
glutamylthreonylarginylphenylalanyllys…
glutamylglycylasparaginylglutamyltyros…
methionylalanylglutamylasparaginylalan…
ylserylglycylisoleucylserylarginylleuc…
tamylprolylvalylasparaginylprolylproly…
yllysylvalylthreonylaspartylthreonylse…
eucylglutamyltryptophylseryllysylproly…
cylmethionylglutamylisoleucylisoleucyl…
amylmethionylcysteinyllysylthreonylasp…
histidyllysylvalylasparaginylalanylglu…
nylarginyltyrosylthreonylvalylthreonyl…
lglutamylglutamyltyrosyllysylphenylala…
asparaginylglycylalanylglycyllysylglyc…
ylthreonylglycylthreonylisoleucyllysyl…
eonylalanylprolylglutamylleucylasparty…
phenylalanyllysylglutaminylthreonylhis…
lanylserylisoleucylarginylleucylphenyl…
nylglycylarginylprolylthreonylprolylth…
ylprolylaspartylserylasparaginylleucyl…
leucylhistidylthreonylthreonylaspartyl…
lthreonylvalylglutamylasparaginylcyste…
partylalanylglycyllysyltyrosylthreonyl…
nylasparaginylserylglycylseryllysylser…
onylvalyllysylvalylleucylaspartylthreo…
olylisoleucylthreonylphenylalanyllysyl…
erylalanylthreonylleucylmethionyltrypt…
ylaspartylglycylglycylalanylarginyliso…
alylglutamyllysylarginylglutamylalanyl…
lutaminylvalylisoleucylserylglutamylly…
ylisoleucylphenylalanyllysylvalylaspar…
lycylvalylprolyltyrosyltyrosylphenylal…
araginylglutamyltyrosylglycylvalylglyc…
ionylprolylglutamylprolylisoleucylvaly…
olylalanylprolylprolylarginylarginylle…
nylseryllysylserylserylalanylvalylleuc…
aspartylhistidylaspartylglycylglycylse…
rosylleucylleucylglutamylmethionylargi…
ylleucyltryptophylvalylglutamylalanylg…
lleucylthreonylphenylalanylthreonylval…
llysylthreonylglutamyltyrosylglutamylp…
ysylasparaginylaspartylalanylglycyltyr…
mylalanylphenylalanylserylserylvalylis…
glutaminylisoleucylglutamylprolylthreo…
ylisoleucylthreonylasparaginylglutamin…
ysylalanylglycylserylprolylphenylalany…
ylisoleucylserylglycylarginylprolylala…
yllysylleucylglutamylglutamylmethionyl…
spartylarginylvalylserylisoleucylthreo…
inylthreonylthreonylleucylthreonylvaly…
glycylaspartylserylglycylarginyltyrosy…
utamylasparaginylthreonylalanylglycylv…
alylthreonylvalylvalylvalylisoleucylgl…
hreonylglycylprolylisoleucylglutamylva…
ylserylcysteinylvalylleucylseryltrypto…
ylglycylglycylglycylthreonylglutamylis…
oleucylvalylglutamyllysylarginylglutam…
tryptophylglutaminylleucylvalylasparag…
onylglutaminylisoleucyllysylvalylthreo…
ylmethionylglutamyltyrosylserylphenyla…
asparaginylarginylphenylalanylglycylva…
rylalanylprolylisoleucylisoleucylalany…
valylprolylprolylserylalanylprolylthre…
ylhistidylvalylserylalanylasparaginyla…
tryptophylglutamylglutamylprolyltyrosy…
ysylisoleucylisoleucylglycyltyrosyltry…
mylarginylasparaginylthreonylisoleucyl…
sparaginyllysylvalylprolylcysteinylleu…
syllysylvalylthreonylglycylleucylvalyl…
glutaminylphenylalanylarginylthreonylt…
alanylglycylvalylseryllysylalanylseryl…
leucylmethionylalanylglutaminylasparag…
glycylarginylprolylglutamylvalylthreon…
threonylvalylserylleucylisoleucyltrypt…
aspartylglycylglycylseryllysylvalylval…
utamylarginyllysylprolylvalylserylglut…
ltryptophylleucyllysylcysteinylasparag…
rylaspartylasparaginylphenylalanylphen…
leucylserylglutamylglycylaspartylthreo…
ylvalylleucylalanyllysylasparaginylala…
ysylglycylserylglutamylserylthreonylgl…
inylaspartylglutamyltyrosylalanylproly…
artylalanylarginylleucylhistidylglycyl…
larginylalanylglycylserylaspartylleucy…
ylglycylglycyllysylprolylglutamylproly…
hreonyllysylglycylaspartyllysylglutamy…
myllysylvalylserylleucylglutaminyltyro…
threonylalanylvalylisoleucyllysylpheny…
laspartylserylglycyllysyltyrosylthreon…
ylalanylserylglycylthreonyllysylalanyl…
alylleucylaspartylserylprolylglycylpro…
ylvalylserylarginylvalylthreonylglutam…
eucylalanyltryptophylserylleucylprolyl…
cylalanylglutamylisoleucylthreonylhist…
ginylarginylglutamylthreonylserylargin…
soleucylvalylglutamylglycylglutamylcys…
sylvalylvalylthreonylarginylleucylisol…
tamyltyrosylisoleucylphenylalanylargin…
llysyltyrosylglycylprolylglycylvalylpr…
lisoleucylvalylalanylarginylasparaginy…
prolylserylprolylprolylglycylisoleucyl…
reonylglycyllysylglutamylhistidylisole…
ptophylthreonyllysylprolylglutamylsery…
tamylisoleucylserylasparaginyltyrosyll…
myllysylglutamylserylleucylarginyltryp…
yllysylaspartyltyrosylvalylvalyltyrosy…
valylthreonylserylleucylmethionylgluta…
utaminylphenylalanylarginylvalylthreon…
lglycylasparaginylserylglutamylprolyls…
phenylalanylisoleucylserylcysteinylarg…
nylprolylglycylprolylprolylserylalanyl…
onylthreonyllysylhistidylserylisoleucy…
llysylprolylmethionyltyrosylaspartylgl…
valylglycyltyrosylvalylleucylglutamylm…
rtylthreonylaspartylglutaminyltryptoph…
ylasparaginylalanylthreonylisoleucylar…
nylalanylthreonylvalylprolylaspartylle…
ysyltyrosylserylphenylalanylarginylval…
lysylglycylmethionylserylglutamyltyros…
glutamylisoleucylglutamylprolylvalylgl…
ucylprolylaspartylleucylglutamylleucyl…
sylthreonylvalylthreonylisoleucylargin…
nylleucylmethionylvalylserylvalylseryl…
lisoleucylthreonyltryptophylseryllysyl…
ucylalanylserylarginylalanylisoleucyli…
tamylseryltyrosylserylleucylleucylisol…
inylarginyltyrosylaspartylalanylglycyl…
ylalanylglutamylasparaginylglutaminyls…
onylvalylleucylvalyllysylvalyltyrosyla…
steinylprolylserylvalyllysylvalyllysyl…
rylvalylthreonylisoleucylthreonyltrypt…
lisoleucylaspartylglycylglycylalanylpr…
tyrosylisoleucylvalylglutamyllysylargi…
inylalanylphenylalanyllysylthreonylval…
yllysylthreonylleucyltyrosylarginyliso…
lglycylthreonylmethionylhistidyltyrosy…
ylglutamylasparaginylisoleucyltyrosylg…
ysteinylglutamylthreonylserylaspartyla…
alylprolylleucylvalylprolylalanyllysyl…
ylthreonyllysylserylthreonylvalylthreo…
sylprolylleucyltyrosylaspartylglycylgl…
ltyrosylvalylleucylglutamylalanylcyste…
ylarginyltryptophylmethionyllysylvalyl…
nylvalylleucylglutamylhistidylthreonyl…
glutamylglycylglutamylglutaminyltyrosy…
arginylalanylglutaminylasparaginylglut…
olylarginylglutamylthreonylvalylthreon…
laspartylleucylarginylvalylleucylproly…
ylthreonylmethionylprolylglutaminyllys…
lylalanylglycylarginylprolylvalylgluta…
cylalanylglycylarginylprolylprolylprol…
alanylphenylalanylalanylglycylseryllys…
larginylvalylthreonylvalylglutamylthre…
llysylleucylthreonylisoleucylarginylgl…
nylaspartylthreonylglycylglutamyltyros…
asparaginylvalylthreonylglycylthreonyl…
cyllysylvalylisoleucylisoleucylleucyla…
lthreonylglycylprolylisoleucyllysyliso…
rtylalanylthreonylserylisoleucylthreon…
rolylprolylglutamylleucylaspartylglycy…
ltyrosylvalylvalylglutamylglutaminylar…
rolylglycyltryptophylleucylprolylvalyl…
nylserylthreonylphenylalanyllysylpheny…
lglutamylglycylasparaginylglutamyltyro…
nylalanylthreonylasparaginylarginylphe…
tyrosylleucylglutaminylserylglutamylva…
lserylserylisoleucylarginylisoleucylpr…
nylleucylglutaminylisoleucylphenylalan…
glycylmethionylthreonylleucylthreonylt…
laspartylaspartylglycylglycylserylglut…
leucylvalylglutamylarginyllysylglutamy…
ryptophylvalylarginylvalylasparaginyll…
ylthreonylarginyltyrosylarginylserylth…
lycylleucylglutamyltyrosylglutamylhist…
ucylasparaginylalanylarginylglycylsery…
lseryllysylprolylisoleucylvalylalanylm…
ylprolylprolylglycyllysylprolylglutami…
eonylaspartylthreonylthreonylarginylth…
yptophylserylvalylprolylglutamylaspart…
ylthreonylglycyltyrosylleucylisoleucyl…
ylaspartylglutaminylhistidylglutamyltr…
aginylthreonylthreonylprolylthreonylly…
hreonylleucylthreonylhistidylleucylpro…
rosylarginylphenylalanylarginylvalylle…
lglycylglycylprolylglycylglutamylproly…
eonylvalyllysylvalylthreonylglutamylme…
spartyltyrosylglutamylleucylaspartylgl…
mylglycylisoleucylphenylalanylvalylarg…
eucylarginylleucylthreonylisoleucylpro…
henylalanylprolylisoleucylcysteinyllys…
ycylglutaminylaspartylisoleucylserylly…
lanylthreonylserylglutamylthreonylhist…
eucyllysylglutamylalanylaspartylarginy…
yrosylaspartylleucylvalylleucylglutamy…
yllysylalanylvalyltyrosylisoleucyllysy…
rylprolylasparaginylserylprolylglutamy…
spartylaspartylisoleucylglutaminylvaly…
tryptophylarginylprolylprolylalanylasp…
rtylisoleucylleucylglycyltyrosylisoleu…
amylvalylprolyllysylalanylalanyltrypto…
lserylarginylvalylarginylglycylthreony…
ucyllysylglutamylasparaginylvalylgluta…
ylvalylserylalanylglutamylasparaginylg…
lseryllysylprolylleucyllysylserylgluta…
llysylthreonylprolylleucylasparaginylp…
lasparaginylprolylprolylglutamylvalyll…
lserylvalylserylleucylseryltryptophyls…
tylglycylglycylserylarginylvalylthreon…
amylarginyllysylglutamylthreonylserylt…
ylhistidylasparaginyllysylthreonylglut…
onylmethionyltyrosylthreonylvalylthreo…
lanylglutamyltyrosylglutaminylphenylal…
glutaminylasparaginylaspartylvalylglyc…
rolylalanylserylglutamylprolylvalylval…
lalanylaspartyllysylprolylserylglutami…
ylisoleucylleucylserylisoleucylserylly…
glutaminyltryptophylglutamyllysylproly…
cyllysylglutamylisoleucylleucylglycylt…
larginylglutaminylserylglycylaspartyls…
asparaginyllysylglutamylarginylisoleuc…
lalanylthreonylisoleucylglycylglycylle…
tamyltyrosylglutamylphenylalanylarginy…
araginylglutamylthreonylglycylleucylse…
nylalanylmethionylserylisoleucyllysylt…
ylglutamylalanylprolylglycylisoleucyla…
partylvalylthreonylthreonyllysylleucyl…
lleucylserylcysteinylglutaminylisoleuc…
lylaspartylisoleucyllysyltryptophyltyr…
lutamylleucylisoleucylglutaminylseryla…
ylserylaspartylglycylarginylthreonylhi…
thionylthreonylglutamylglutamylglutami…
lyltyrosylthreonylcysteinylisoleucylal…
lglycylglutamylvalylglutamylthreonylse…
aminylalanylthreonylprolylglutaminylph…
ylprolylleucyllysylglutamyllysyltyrosy…
lthreonylleucylarginylleucylhistidylva…
rginylprolylvalylprolylalanylmethionyl…
dylglycylglutaminyllysylleucylleucylgl…
araginylisoleucylthreonylisoleucylglut…
idyltyrosylthreonylhistidylleucylvalyl…
minylarginyllysylthreonylhistidylalany…
inylleucylserylasparaginylvalylphenyla…
nylisoleucylleucylaspartylvalylglutamy…
olylaspartyllysylprolylthreonylglycylp…
lalanylleucylleucyllysylasparaginylser…
yllysylprolylprolylalanylaspartylaspar…
ucylthreonylasparaginyltyrosylvalylval…
nyllysylglutamylglycylalanylglutamyltr…
erylalanylisoleucylserylvalylthreonylt…
ylasparaginylleucylthreonylglutamylasp…
henylalanylarginylvalylserylalanylglut…
ylglycylisoleucylserylaspartylprolylle…
ylisoleucylisoleucyllysylserylprolylph…
alanylprolylglycyllysylprolylthreonyli…
lysylaspartylserylcysteinylvalylvalyla…
nylserylaspartylglycylglycylalanyllysy…
tyrosylleucylglutamyllysylarginylgluta…
ysyltryptophylisoleucylserylvalylthreo…
larginylglutamylthreonylvalylphenylala…
isoleucylglutamylglycylleucylglutamylt…
lyllysylcysteinylglutamylasparaginylle…
yltryptophylserylglutamylisoleucylsery…
lyllysylserylaspartylvalylprolylisoleu…
enylalanyllysylglutamylglutamylleucyla…
alylarginyltyrosylglutaminylserylaspar…
einyllysylvalylthreonylglycylhistidylp…
tryptophyltyrosylarginylglutaminylglyc…
anylaspartylglycylleucyllysyltyrosylar…
nylalanyllysylglycylglycyltyrosylhisti…
ylalanylserylvalylthreonylaspartylaspa…
sylglutaminylvalylarginylalanylthreony…
erylvalylserylglycylthreonylalanylsery…
olylalanyllysylisoleucylhistidylleucyl…
ycylmethionylglycylalanylvalylhistidyl…
lylvalylserylisoleucyllysylisoleucylpr…
lylaspartylprolylvalylisoleucylthreony…
taminylaspartylleucylisoleucylaspartyl…
ltyrosylglutaminylvalylisoleucylvalylt…
onylserylleucylvalylphenylalanylprolyl…
yllysylaspartylalanylglycylphenylalany…
sylasparaginylarginylphenylalanylglycy…
reonylvalylglutamylleucylaspartylvalyl…
olylprolylarginylglycylvalyllysylvalyl…
rtylserylvalylasparaginylleucylthreony…
anylserylaspartylglycylglycylseryllysy…
lisoleucylvalylglutamyllysylcysteinyla…
arginyltryptophylleucylarginylvalylgly…
hreonylarginyltyrosylthreonylvalylisol…
lycyllysylthreonylseryltyrosylglutamin…
alanylglutamylasparaginyllysylphenylal…
ylglutamylprolylserylglutamylprolylthr…
aspartyllysylthreonylarginylalanylmeth…
amylglutamylvalylaspartylglutamylthreo…
ylthreonyllysylalanylserylhistidylsery…
rosylglutamyllysyltyrosylmethionylisol…
ycylarginylglycylglutamylphenylalanylg…
ysteinylvalylglutamylthreonylserylsery…
alanyllysylphenylalanylvalyllysylvalyl…
ylvalylleucylvalyllysyllysylglutamylis…
nylisoleucylalanylarginylhistidylargin…
lleucylhistidylglutamylserylphenylalan…
tamylleucylvalylmethionylisoleucylphen…
ylserylglycylleucylaspartylisoleucylph…
sparaginylthreonylserylalanylphenylala…
larginylglutamylisoleucylvalylseryltyr…
teinylglutamylalanylleucylglutaminylph…
ylasparaginylisoleucylglycylhistidylph…
rolylglutamylasparaginylisoleucylisole…
larginylserylserylthreonylisoleucyllys…
lanylglycylglutaminylalanylarginylglut…
ylasparaginylphenylalanylarginylleucyl…
lylglutamyltyrosyltyrosylalanylprolylg…
dylaspartylvalylvalylserylthreonylalan…
ylserylleucylglycylthreonylleucylvalyl…
isoleucylasparaginylprolylphenylalanyl…
inylglutaminylglutaminylisoleucylisole…
hionylasparaginylalanylglutamyltyrosyl…
lglutamylalanylphenylalanyllysylglutam…
anylmethionylaspartylphenylalanylvalyl…
ylglutamylarginyllysylserylarginylmeth…
nylleucylglutaminylhistidylprolyltrypt…
eucylglutamylarginylvalylserylthreonyl…
eucyllysylhistidylarginylarginyltyrosy…
ucyllysyllysylaspartylleucylasparaginy…
ylarginylisoleucylserylcysteinylglycyl…
utaminyllysylglycylvalylserylvalylalan…
oleucylglutamylisoleucylglycylprolylva…
thionylhistidylalanylvalylglycylglutam…
lysyltyrosylvalylcysteinyllysylisoleuc…
lglutaminylserylthreonylglutaminylvaly…
nylglycylvalylarginylglutaminylleucylg…
ltyrosylglutamylisoleucylthreonyltyros…
isoleucylleucyltyrosylvalyllysylaspart…
tylaspartylglycylthreonyltyrosylarginy…
laspartyltyrosylglycylglutamylaspartyl…
ylphenylalanylvalyllysylglycylvalylarg…
osyltyrosylcysteinylarginylarginylthre…
ylarginylarginylthreonylaspartylthreon…
mylarginylprolylprolylglutamylphenylal…
ylasparaginyllysylthreonylalanyltyrosy…
larginylphenylalanylglycylvalylthreony…
ylglutamylprolylhistidylvalylthreonylt…
taminyllysylisoleucyllysylprolylglycyl…
yltyrosylthreonylphenylalanylglutamyls…
lglutaminylleucylthreonylisoleucylaspa…
partylaspartylaspartylalanylglutamylty…
lasparaginyllysyltyrosylglycylglutamyl…
sylleucylthreonylvalylthreonylleucylhi…
artylserylthreonylleucylarginylprolylm…
cylleucylalanylasparaginylalanylglutam…
glutaminylserylvalylcysteinylphenylala…
ylglycylisoleucylprolylprolylprolylthr…
ysylaspartylglycylglutaminylprolylleuc…
lisoleucylglutamylisoleucylisoleucylhi…
yrosyltyrosylalanylleucylhistidylisole…
olylglutamylaspartylthreonylglycyltyro…
lthreonylasparaginylthreonylalanylglyc…
inylalanylhistidylleucylglutaminylvaly…
llysyllysylglutaminylglutamylphenylala…
istidylglutamylarginylhistidylvalylglu…
rtyllysylthreonylleucylarginylmethiony…
glycylthreonylglutamylserylvalylprolyl…
lysylglutamylalanylleucylarginylglutam…
ylprolylalanylvalylserylthreonyllysylt…
ylalanylarginylleucylglutamylisoleucyl…
lutamylarginyllysylleucylarginylmethio…
glutamylprolylarginyllysyltyrosyllysyl…
glutamylglutamylaspartylglutaminylargi…
anylvalylprolylmethionylserylaspartylm…
lysylisoleucylarginylaspartylglutaminy…
yllysylleucylaspartylarginylvalylvalyl…
ginylisoleucylarginylleucylserylarginy…
alanyltyrosylvalylmethionylprolylleucy…
rtylglutaminyltyrosylarginylprolyllysy…
sylleucylserylglutaminylaspartylaspart…
ylprolylalanylarginylarginylarginylthr…
ylaspartylphenylalanyltyrosyltyrosylar…
ylleucylglycylaspartylisoleucylserylas…
eucylprolylisoleucylaspartylaspartylty…
nylthreonylglutamylglutamylglutamylarg…
amylglutamylleucylglutamylleucylglycyl…
rolylserylarginylserylprolylprolylhist…
serylleucylarginyltyrosylserylserylpro…
ylvalylglutamylglutamylthreonylarginyl…
tyrosylserylthreonyltyrosylhistidyliso…
amylalanylserylthreonylseryltyrosylala…
inylhistidylalanylglutaminylalanylalan…
ylglutaminylarginylglutaminylarginylis…
ylglutamylaspartylglutamylglutamylleuc…
hreonylthreonylglutaminylhistidylleucy…
amylleucylaspartylphenylalanylmethiony…
ylarginyllysyllysylserylarginylarginyl…
nylglutamylisoleucylthreonylglutamylis…
sylglutamylisoleucylseryllysylhistidyl…
lserylserylserylalanylserylarginylleuc…
lserylleucylserylprolylthreonyltyrosyl…
inylprolylvalylserylglutamylleucylisol…
minylprolylalanylglutamylglutamyltyros…
lutamylarginylarginylserylprolylthreon…
nylprolylarginylserylprolylserylprolyl…
leucylserylarginylphenylalanylglutamyl…
ylaspartylisoleucylphenylalanylserylar…
ysylalanylalanylleucyllysylthreonylglu…
ginyllysyltyrosylglutamylvalylleucylse…
alanylthreonylleucylaspartylhistidylal…
eucylarginylmethionylarginylserylhisti…
lglutaminylasparaginylthreonylarginylp…
ylvalylglutaminylseryllysylprolylthreo…
yltyrosylhistidylasparaginylglycylvaly…
rylseryllysylisoleucylhistidyltyrosylt…
ylvalylleucylthreonylleucylglutamyliso…
ylthreonylaspartylaspartylserylglycylt…
teinylthreonylasparaginyltyrosyllysylg…
osylalanylthreonylleucylaspartylvalylt…
hreonylthreonyltyrosylalanylserylgluta…
glutamylvalylprolylarginylserylvalylph…
nylarginylthreonylglutamylalanyltyrosy…
lysyllysylthreonylserylglutamylmethion…
larginylglutamylvalyllysylserylglutami…
larginylglutamylserylleucylserylserylt…
rylalanylglutamylmethionyllysylserylal…
ylserylleucylglutamylglutamyllysylsery…
cyllysylthreonylthreonylleucylalanylal…
ysylprolylarginylserylmethionylthreony…
serylalanylarginylphenylalanylserylcys…
lglutamylprolylvalylprolylthreonylvaly…
ylglycylglutaminylvalylleucylserylthre…
minylvalylthreonylthreonylthreonyllysy…
nylglutamylisoleucylserylserylvalylglu…
lycylasparaginyltyrosylserylvalylvalyl…
ylglycyllysylglutaminylglutamylalanylg…
reonylisoleucylglutaminyllysylalanylar…
ylvalylthreonylserylprolylprolylarginy…
larginylvalyllysylserylprolylglutamyla…
nylvalyllysylserylprolylglutamylprolyl…
serylprolylthreonylglutamylthreonyllys…
yllysylvalylglutaminylhistidylleucylpr…
ylisoleucylthreonylglutaminylphenylala…
eryllysylglutamylisoleucylalanyllysyll…
tamylserylserylvalylleucylarginylalany…
yltyrosyllysylaspartylglycyllysyllysyl…
lhistidylphenylalanylglutaminylphenyla…
rtylglycylthreonyltyrosylglutamylleucy…
ylleucylthreonylglutamylserylaspartylg…
cysteinylglutamylisoleucylserylglycylg…
ylthreonylasparaginylleucylglutaminylp…
lalanylphenylalanyllysylserylisoleucyl…
lisoleucylserylglutamylthreonyllysylly…
onylthreonylglutamylserylthreonylvalyl…
lprolyllysylalanylprolylglutamylprolyl…
isoleucylvalylthreonylglycylleucylglut…
serylserylaspartylserylvalylalanyllysy…
threonylglycylglutamylprolylarginylpro…
lthreonyllysylaspartylglycyllysylalany…
lycyllysyltyrosyllysylleucylserylgluta…
lanylphenylalanylleucylglutamylisoleuc…
onylserylaspartylserylglycylleucyltyro…
sylasparaginylserylalanylglycylserylva…
cylthreonylisoleucyllysylalanylisoleuc…
ylglutaminyllysylvalylserylthreonylglu…
oleucylthreonylprolylglutaminyllysylly…
ylglutamylisoleucylserylglutaminyllysy…
utamylisoleucyllysylmethionylserylglut…
myllysylleucylalanylleucyllysylglutamy…
lisoleucylserylglutamylglutamylvalylly…
rylleucylglutamyllysylserylisoleucylva…
lthreonyllysylthreonylserylglutaminyla…
nylthreonylhistidylalanylglutamylisole…
eonylglutaminylmethionylserylisoleucyl…
arginylleucylvalylleucyllysylalanylasp…
threonylaspartylvalyllysyltryptophylva…
amylleucylthreonylasparaginylserylglut…
ycylvalylserylglycylserylaspartylgluta…
llysylglutaminylalanylserylhistidylarg…
leucylthreonylcysteinylisoleucylseryll…
eucylvalyllysylcysteinylglutaminyltyro…
llysylglutamylleucylserylaspartylalany…
erylglutaminylprolylarginylserylglutam…
glutamylglycylglutaminylasparaginylval…
ylglutamylisoleucylserylglycylglutamyl…
lutamyltryptophylphenylalanyllysylaspa…
ucylserylisoleucylserylserylasparaginy…
ylarginylasparaginylvalyltyrosylseryll…
ginylalanylserylvalylserylaspartylsery…
llysylalanyllysylasparaginylphenylalan…
erylalanylthreonylalanylserylleucylmet…
lutamylglutamylprolylserylarginylgluta…
erylglycylaspartylthreonylserylleucylg…
ylserylglutaminylserylvalylglutaminylm…
inylglutamylalanylserylphenylalanylser…
erylalanylserylserylmethionylthreonylg…
anylserylmethionylserylalanylglutaminy…
lutaminylglutamylserylphenylalanylvaly…
rylphenylalanylmethionylglycylisoleucy…
lutaminylleucylglutamylserylserylthreo…
anylglycylisoleucylarginylglycylisoleu…
ylalanylleucylprolylserylaspartylisole…
lycyllysylvalylleucylthreonylvalylalan…
ylglycylglutamylprolylthreonylprolylgl…
ysteinylglycylglycylarginyllysylisoleu…
lutaminylglycylarginylphenylalanylhist…
eonylaspartylaspartylleucylthreonylthr…
nylaspartylvalylglutaminyllysylglutami…
lthreonylleucylserylleucylglycylaspara…
laspartylserylalanylthreonylvalylaspar…
inylserylisoleucine

[size=5]Source(s):[/size]
http://en.wikipedia.org/wiki/Titin
  • 62 people rated this as good

Asker's Rating:Asker's Comment:i am supprised it was on that page because, i also have went on that page, but didn't find it…



[size=5]Other Answers (3)[/size]

  • Titin, also known as connectin, (UniProt name: Q10466_HUMAN; accession number: Q10466) is a protein that is important in the contraction of striated muscle tissues. Titin connects the Z line to the M line in the sarcomere. The protein limits the range of motion of the sarcomere in tension, thus contributing to the passive stiffness of muscle. Variations in the sequence of titin between different types of muscle (e.g. cardiac or skeletal) has been correlated with differences in the mechanical properties of the muscles. Titin is the largest known protein, consisting of 26,926 amino acids. The molecular weight of the mature protein is approximately 2,993,451.39 Da, and it has a theoretical pI of 6.35 [1]. The protein's chemical formula is C132983H211861N36149O40883S693. It has a theoretical instability index (II) of 39.69, indicating that it would be stable in a test tube. The protein's in vivo half-life, the time it takes for half of the amount of protein in a cell to disappear after its synthesis in the cell, is predicted to be approximately 30 hours (in mammalian reticulocytes). As the largest known protein, titin has the longest full chemical name. The full chemical name, containing 189,819 letters, is sometimes claimed to be the longest word in the English language: Methionylthreonylthreonylglutaminylala… ylglutaminylprolylleucylglutaminylsery… lserylthreonylalanylthreonylphenylalan… rylglycylphenylalanylprolylvalylprolyl… lanylarginylaspartylglycylglutaminylva… nylleucylprolylglycylvalylglutaminylis… ylglycylarginylalanyllysylleucylthreon… llysylalanylasparaginylserylglycylargi… eonylasparaginylglycylserylglycylgluta… nylglutamylleucylleucylvalyllysylalany… asparaginylphenylalanylvalylglutaminyl… ylthreonylvalylarginylglutaminylglycyl… utaminylvalylarginylvalylthreonylglycy… lylvalyllysylphenylalanyltyrosylarginy… cylglutaminylserylserylleucylaspartylp… glutaminylglutamylglycylaspartylleucyl… anylglutamylalanyltyrosylprolylglutamy… serylvalylasparaginylalanylthreonylasp… ylthreonylserylthreonylalanylglutamyll… tamylglutamylglutamylvalylprolylalanyl… eucylvalylserylthreonylalanylglutaminy… glutaminylthreonylarginylisoleucylglut… ylhistidylphenylalanylaspartylalanylar… lylglutamylmethionylvalylisoleucylaspa… nylglutaminylleucylprolylhistidyllysyl… lprolylprolyllysylprolyllysylserylargi… erylisoleucylalanylalanyllysylalanylgl… ylglutaminylserylprolylserylprolylisol… lprolylvalylarginylhistidylvalylarginy… lylvalylarginylserylvalylserylprolylal… onylserylprolylisoleucylarginylserylva… thionylarginyllysylthreonylglutaminyla… ylglycylprolylglutamylvalylprolylproly… tamylglycyltyrosylvalylalanylserylsery… ylarginylglutamylthreonylthreonylleucy… minylisoleucylarginylthreonylglutamylg… cylarginyltyrosylglycylvalylglutaminyl… eucylserylglycylalanylalanylglycylalan… serylalanylseryltyrosylalanylalanylglu… lalanyllysylglutamylvalyllysylglutamin… lanylalanylvalylalanylthreonylvalylval… lalanylarginylvalylarginylglutamylprol… tamylglutaminylthreonylalanylglutaminy… eonylalanylvalylhistidylisoleucylgluta… glutaminylvalylarginyllysylglutamylala… threonyllysylvalylvalylvalylalanylalan… lutaminylglutamylleucyllysylserylargin… leucylthreonylthreonyllysylglutaminylg… alylthreonylhistidylglutamylglutaminyl… ylglutamyllysylthreonylphenylalanylval… ylalanylalanyllysylalanyllysylglutamyl… oleucylserylglutamylglutamylisoleucylt… taminylvalylthreonylglutaminylglutamyl… ylthreonylarginyllysylthreonylvalylval… nylthreonylprolyllysylvalyllysylglutam… larginylglycylarginylglutamylglycyliso… lutamylglutaminylvalylglutaminylisoleu… ethionylarginyllysylglutamylalanylglut… hreonylisoleucylalanylvalylalanylthreo… utaminylglutamylthreonylisoleucylleucy… onylmethionylalanylthreonylarginylglut… utaminylvalylthreonylhistidylglycyllys… lalanylglutamylalanylvalylalanylthreon… ylglutaminylalanylarginylvalylarginylg… lycylhistidylleucylglutamylglutamylser… threonylthreonylleucylglutamyltyrosylg… leucylserylalanylalanyllysylvalylalany… nylprolylalanylserylglutamylprolylhist… llysylprolylarginylvalylisoleucylgluta… nylhistidylisoleucyllysylthreonylthreo… hionylhistidylisoleucylserylserylgluta… eonylaspartylleucylthreonylthreonylglu… laspartyllysylarginylprolylarginylthre… alanylthreonylvalylseryllysylisoleucyl… ylhistidylglycyltyrosylglutamylalanyls… lisoleucylalanylthreonylleucylglutamin… eonylserylserylalanylglutaminyllysylis… alanylprolylthreonylvalyllysylprolylse… nylalanylglutamylprolylthreonylprolyll… olylphenylalanylalanylaspartylthreonyl… erylglutamylalanylglycylvalylglutamylv… lylserylisoleucylthreonylglycylthreony… ylarginylphenylalanylglutamylvalylleuc… yllysylvalylthreonylglutamylthreonylal… alylglutamylisoleucylprolylvalylthreon… rylglycylleucyllysylasparaginylvalylth… lutamylserylvalylthreonylleucylglutamy… cyltyrosylprolylserylprolylthreonylval… lutamylaspartyltyrosylglutaminylisoleu… tylphenylalanylglutaminylisoleucylthre… ylisoleucylalanylarginylleucylmethiony… ylalanylalanylglutamylaspartylserylgly… inylserylalanylvalylasparaginylglutamy… onylserylcysteinyltyrosylleucylalanylv… tamylphenylalanylglutamyllysylglutamyl… glutamyllysylphenylalanylthreonylthreo… ylalanylvalylglutamylserylarginylaspar… tylthreonylserylleucylthreonylglutamyl… lglycylglutamylprolylalanylalanylproly… yllysylprolylvalylvalylglutaminyllysyl… lvalylvalylphenylalanylglycylcysteinyl… nylprolyllysylprolylhistidylvalyltyros… lylprolylleucylthreonylthreonylglycylt… tyrosylasparaginyllysylglutaminylthreo… ylvalylisoleucylserylmethionylthreonyl… lanylglycylglutamyltyrosylthreonylisol… sylhistidylglycylglutamylthreonylseryl… lutamylglutamylalanylaspartyltyrosylgl… ylglutaminylglutaminylglutamylmethiony… taminylvalylthreonylalanylphenylalanyl… ylvalylglycylglutamylthreonylalanylpro… rylglutamyltyrosylglutamyllysylglutamy… inylalanylleucylisoleucylarginyllysyll… eonylvalylvalylvalylarginylthreonyltyr… glutamylphenylalanylhistidylisoleucyls… ylarginylleucylisoleucyllysylglutamyli… ucylisoleucyllysylthreonylthreonylleuc… mylglutamylaspartylglycylglutamylgluta… lisoleucylserylglutamylserylglutamylal… lanylaspartylleucylarginylisoleucyllys… lleucylglutamylglycylmethionylglycylva… einyllysylmethionylserylglycyltyrosylp… yltryptophyltyrosyllysylaspartylglycyl… lycylglutamylarginyltyrosylglutaminylm… lutaminylaspartylglycylarginylalanylse… lvalylleucylprolylglutamylaspartylglut… lanylphenylalanylalanylserylasparaginy… nylisoleucylcysteinylserylglycyllysyll… ylalanylprolylleucylglycylalanylprolyl… nylleucylglutamylprolylvalylserylargin… rolylarginylserylvalylserylarginylsery… ylprolylalanylarginylmethionylserylpro… lalanylarginylmethionylserylprolylalan… arginylarginylleucylglutamylglutamylth… ylleucylglutamylarginylleucyltyrosylly… yllysylprolylvalylserylphenylalanyllys… ylasparaginylcysteinylarginylphenylala… cylarginylprolylmethionylprolylglutamy… ylalanylhistidylaspartylglycylglutamin… ylaspartyltyrosylthreonylhistidyllysyl… artylglycylthreonylglutaminylserylleuc… ylthreonylprolylserylaspartylserylglyc… lylalanylglutaminylasparaginylarginyla… ylserylvalylisoleucylleucylthreonylval… ylglutaminylvalyllysylprolylmethionylp… lysylasparaginylvalylasparaginylisoleu… eucylglutamylmethionyllysylvalylarginy… lylasparaginylprolylaspartylisoleucylv… lserylaspartylisoleucylisoleucylvalylp… lisoleucylarginylisoleucylglutamylglyc… alanylleucyllysylisoleucylaspartylsery… ylserylalanyltryptophyltyrosylthreonyl… ginyllysylalanylglycylarginylaspartylt… lvalylasparaginylvalylglutamylvalylglu… ylglutamylprolylglutamylarginyllysylle… glycylthreonyltyrosylarginylalanyllysy… lglutamylleucylglutamylprolylleucylhis… aminylglutamylglutaminyltryptophylglut… osylaspartyllysylglutamyllysylglutamin… phenylalanyllysyllysyllysylleucylthreo… inylphenylalanylglycylprolylalanylhist… ginylleucylthreonylprolylisoleucylsery… ylvalylglutamyltryptophylleucylhistidy… tamylalanylalanylasparaginylarginylleu… inylglutamylphenylalanylglycyltyrosylc… lycylvalylalanyltyrosylserylarginylasp… hreonylcysteinylarginylalanylthreonyla… laspartylhistidylthreonylserylalanylth… rtylglutamyllysylserylleucylvalylgluta… lylglutamylglycylarginyllysylglycylleu… ylglutamylleucylglutamylarginylmethion… lleucylthreonylglycylvalylthreonylthre… lysylglutaminyllysylprolylaspartylisol… ylprolylvalylarginylvalylleucylglutamy… lphenylalanylarginylcysteinylarginylva… minylprolyllysylvalylasparaginyltrypto… lutaminylleucylisoleucylarginyllysylse… alylarginyltyrosylaspartylglycylisoleu… leucylvalylaspartylcysteinyllysylseryl… ylvalyllysylvalylthreonylalanylglutamy… ylisoleucylglutamylhistidyllysylvalyll… ylglutaminylarginylglutamylaspartylphe… inylarginylalanylprolylglutamylprolyla… tidylvalylhistidylglutamylprolylglycyl… utamylvalylglutaminyllysylvalylasparty… threonylglutamylthreonyllysylglutamylv… nylglutamylarginylisoleucylthreonylhis… ylglutamylserylglutamylglutamylleucyla… ginylarginylthreonylglutamylglutamylgl… leucylthreonylalanylvalylglutamylleucy… lglutamylseryltyrosylglutamylglutamyll… laspartylglutamylleucylleucylhistidylt… lthreonylglutamylglutamylglutamyllysyl… amylglycyllysylisoleucylthreonylisoleu… rolylaspartyllysylisoleucylglutamylleu… lalanylprolyllysylisoleucylphenylalany… serylglutaminylthreonylvalylglycylglut… idylphenylalanylarginylvalylarginylval… lylglutamylcysteinylglutamyltryptophyl… ysylisoleucylglutamylarginylserylaspar… ltyrosyltryptophylprolylglutamylaspart… leucylvalylisoleucylarginylaspartylval… ylalanylserylisoleucylmethionylvalylly… cylalanylglycylglutamylthreonylserylse… leucylvalylglutaminylalanyllysylglutam… anylthreonylglutaminylglutamylleucylgl… ylglutamyllysylaspartylthreonylmethion… lcysteinylglutamylthreonylserylglutamy… ysyltryptophyltyrosyllysylaspartylglyc… tamylglycylaspartyllysyltyrosylarginyl… yllysylvalylhistidylphenylalanylleucyl… ylaspartylthreonylserylaspartylalanylg… lvalylleucylvalylglutamylaspartylgluta… eonylalanyllysylleucylisoleucylvalylgl… lphenylalanylvalyllysylglutamylleucylg… alylprolylglutamylseryltyrosylserylgly… soleucylvalylserylprolylglutamylaspara… yptophyltyrosylhistidylasparaginylaspa… paraginylglycyllysyltyrosylthreonyliso… ycylarginylglutaminylasparaginylleucyl… onyllysylglutamylaspartylglutaminylgly… valylisoleucylaspartylglycyllysyllysyl… llysylmethionyllysylprolylarginylproly… aminylglycylleucylserylaspartylglutami… laspartylisoleucylvalylglutaminylleucy… glutamylserylvalylglutamylglycylvalylt… ylglutaminylglutamylvalylglutaminylpro… lisoleucylvalylisoleucylaspartyllysylg… ylleucylisoleucylglutamylaspartylmethi… anylglycylasparaginyltyrosylserylpheny… lleucylglycylleucylserylthreonylserylg… erylvalylaspartylvalylisoleucylthreony… raginylvalylisoleucylglutamylglycylthr… cysteinyllysylvalylserylvalylprolylasp… yptophyltyrosylleucylasparaginylaspart… rolylaspartylaspartylarginylvalylgluta… lthreonyllysylglutaminylarginylleucylv… onylhistidylalanylserylaspartylglutamy… eucylvalylglycylarginylvalylglutamylth… ylleucylserylvalylglutamyllysylisoleuc… cylleucylarginylaspartylleucylthreonyl… utaminylasparaginylvalylvalylphenylala… histidylserylglycylisoleucylaspartylva… lalanyllysylaspartyllysylglutamylisole… yllysylisoleucylglutamylalanylhistidyl… cylthreonylvalylleucylasparaginylmethi… lutamylglycyllysyltyrosylthreonylpheny… sparaginylmethionylthreonylserylglycyl… lglycylalanylisoleucylseryllysylprolyl… eonylvalylalanylglutamylserylglutaminy… tamylcysteinylglutamylvalylalanylaspar… lglutamyltryptophylleucylarginylaspart… ucylthreonylasparaginylasparaginylisol… tylglycylhistidyllysylarginylarginylle… hreonyllysylleucylaspartylaspartylisol… yrosyllysylvalylalanylthreonylseryllys… ylvalylglutamylalanylvalyllysylisoleuc… raginylleucylthreonylvalylthreonylglut… lvalylphenylalanylthreonylvalylglutamy… ginylvalyllysylglycylvalylglutaminyltr… ycylvalylvalylleucylglutamylserylaspar… leucylserylvalyllysylglycylthreonyliso… eucyllysylasparaginylcysteinylalanylis… lyltyrosylglycylphenylalanylarginylleu… erylalanylarginylleucylhistidylvalylgl… oleucyllysyllysylprolyllysylaspartylva… raginylalanylthreonylvalylalanylphenyl… istidylaspartylthreonylvalylprolylvaly… llysylserylvalylglutamylisoleucyllysyl… inylleucylvalylserylglutamylarginyllys… leucylglutaminylasparaginylisoleucylse… lutamyltyrosylthreonylalanylvalylvalyl… inyllysylalanyllysylleucylphenylalanyl… isoleucylthreonyllysylthreonylmethiony… alylprolylglutamylthreonyllysylthreony… teinylglutamylvalylserylhistidylphenyl… thionyltryptophylleucyllysylasparaginy… ylmethionylserylglutamyllysylphenylala… ylglycyllysylleucylhistidylglutaminyll… araginylthreonylserylthreonylglutamyla… reonylphenylalanylvalylcysteinylglycyl… erylalanylthreonylleucylthreonylvalylt… eucylthreonylserylmethionylleucyllysyl… lutamylglutamyllysylaspartylthreonylis… valylthreonylvalylasparaginyltyrosylgl… syltryptophylleucyllysylasparaginylgly… threonylaspartyllysylcysteinylglutamin… lleucylthreonylhistidylserylleucylaspa… alylhistidylphenylalanylglycylaspartyl… phenylalanylvalylalanylglycyllysylalan… ylleucyltyrosylvalylglutamylalanylargi… lanylarginyllysylhistidylisoleucyllysy… lutamyllysyllysylarginylalanylmethiony… mylvalylserylglutamylprolylaspartyliso… phylmethionyllysylaspartylaspartylglut… ucylthreonylaspartylarginylisoleucylly… lysyltyrosylvalylhistidylarginylleucyl… rginylmethionylserylaspartylalanylglyc… nylglycylglycylasparaginylvalylserylth… valylglutamylglycylarginylaspartylvaly… cyllysyllysylglutamylvalylglutaminylva… arginylalanylvalylvalylglutamylphenyla… ylaspartylaspartylvalylaspartylalanylh… ylglycylisoleucylglutamylisoleucylaspa… lutaminylglutamylarginylhistidyllysylt… nylisoleucylhistidylarginylmethionylph… eonylarginylglutaminylserylaspartylala… nylalanylvalylalanylglycylarginylaspar… lleucyltyrosylvalylasparaginylalanylpr… alylleucylglutaminylglutamylleucylglut… minylserylglycyllysylprolylalanylargin… nylisoleucylserylglycylarginylprolylgl… yptophyltyrosyllysylglutamylglutamylgl… ycylphenylalanyllysylcysteinyllysylphe… ylglutaminylglutamyltyrosylthreonylleu… nylphenylalanylprolylglutamylaspartyla… einylglutamylalanyllysylasparaginylasp… ylthreonylserylalanylserylleucylserylv… lvalylserylprolylaspartylglutaminylglu… lylprolylalanylisoleucylisoleucylthreo… reonylvalylthreonylserylglutamylglycyl… alanylglutaminylcysteinylarginylvalyls… ylvalylseryltryptophyltyrosylseryllysy… olylserylarginylphenylalanylphenylalan… lphenylalanylglutamylaspartylthreonylt… ucylalanylglutamylalanyltyrosylprolylg… yltyrosylthreonylphenylalanylvalylalan… glycylglutaminylvalylserylserylthreony… glutamylalanylprolylglutamylserylisole… oleucylglutamylglutaminylglutamylisole… nyllysylglutamylphenylalanylserylseryl… lutamylglutamylglutamylglycylleucylhis… minylleucylseryllysylisoleucylasparagi… ucylleucylserylglutamylserylprolylvaly… anylaspartylserylglutamyllysylglutamyl… phenylalanylisoleucyllysylglutamylvaly… eucylserylmethionylglycylaspartylvalyl… nylvalylisoleucylglycylisoleucylprolyl… tryptophylphenylalanylphenylalanylaspa… nylprolylserylalanylaspartyltyrosyllys… rtylglycylaspartylaspartylhistidylsery… ylalanylthreonyllysylleucylglutamylasp… hreonylcysteinylmethionylalanylserylas… threonylisoleucylcysteinylserylalanylt… ylseryllysylglycylglutamylglycylhistid… onylglutamylserylalanylvalylalanyllysy… ylglycylprolylcysteinylprolylprolylhis… lleucyllysylprolylisoleucylarginylcyst… olylalanylisoleucylphenylalanylglutamy… tamylprolylalanylprolylthreonylvalylth… utamylasparaginyllysylglutaminylleucyl… yrosylthreonylisoleucylisoleucylhistid… lserylglycylthreonylphenylalanylisoleu… utaminylarginylglutamylaspartylserylgl… lysylalanylglutamylasparaginylmethiony… ysteinylalanylalanylglutamylleucylleuc… threonylaspartylmethionylthreonylaspar… yllysylserylthreonylprolylglutamylalan… lprolylglutaminylthreonylprolylleucyll… alanylleucylaspartylserylglutamylgluta… lphenylalanylvalyllysylaspartylthreony… ucylisoleucylthreonylglutamylglutamyla… lseryltyrosylglutamylhistidylisoleucyl… lleucylserylserylglutaminylleucylproly… ylleucylglutaminylserylisoleucylleucyl… ylthreonylprolylglutamylserylthreonyla… teinylisoleucylasparaginylglycylseryli… nylprolylleucyllysylglutamylprolylsery… eucylglutaminylisoleucylvalylglutaminy… alanylseryllysylglutamylglycylisoleucy… mylprolylglutamylthreonylglutaminylala… glutamyllysylisoleucylphenylalanylprol… lglutamylglutaminylisoleucylasparaginy… olylleucyllysylthreonylleucylleucylala… raginyltyrosylprolylglutaminylserylser… ionylhistidylseryltyrosylleucylthreony… lylleucylserylleucyllysylglutamyllysyl… sparaginylarginylglutamylglutaminylarg… sylglutaminylglutamylalanylglutaminyls… lglutaminylserylleucylalanylglutamylgl… lglutaminylserylprolylaspartylvalylmet… asparaginyltyrosylglutamylprolylleucyl… ylcysteinylthreonylglutamylglycylglycy… mylserylalanylasparaginylprolylleucylg… minylaspartylserylalanylvalylarginylis… erylleucylarginylphenylalanylprolylleu… lglutaminylvalylleucylleucyllysylgluta… araginylvalylvalylmethionylprolylproly… ylglutamylseryllysylarginylglutamylpro… lylglutaminylglutamylvalylglutaminylgl… llysylglutamylserylleucylleucylserylgl… glutaminylarginylleucylasparaginylleuc… cysteinylarginylalanylleucylglutaminyl… lglutaminylprolylglycylleucylphenylala… inylasparaginylisoleucylglutamyllysylv… lasparaginylisoleucylthreonylglutaminy… ucylmethionylcysteinylmethionyltyrosyl… serylvalylthreonylglutamylglutamylvaly… lglutamylaspartylvalylaspartylprolylgl… eucyllysylmethionylglutamylleucylargin… ylisoleucylisoleucyltyrosylglutamylglu… ylthreonylalanylglutamylglycylprolylar… lycylalanyllysylthreonylserylleucylglu… artylserylphenylalanylserylglycylseryl… soleucylthreonylglutamylprolylglutamyl… lisoleucylserylthreonylglutamylglutamy… aginylvalylglutaminylserylarginylvalyl… eonylprolylvalylthreonyllysylglycylval… spartylglutamyllysylglutaminylaspartyl… glutamylglutamyllysylglutamylglutamyls… reonylglutamylglutamylvalylalanylthreo… tamylalanylglutamylglycylglycylleucyli… prolylmethionylisoleucylhistidylthreon… valylserylglutamylglutamylglycylaspart… nylthreonylserylisoleucylthreonylaspar… aginyltryptophyltyrosylphenylalanylglu… lylserylaspartylglutamyllysylphenylala… partylglutaminylasparaginylthreonyltyr… artyllysylvalylasparaginylthreonylglut… lglutamyltyrosylvalylcysteinylglutamyl… lglycyllysylthreonylalanylthreonylsery… llysylarginylalanylalanylprolylvalylis… utamylprolylleucylglutamylvalylalanyll… lphenylalanylthreonylcysteinylglutamyl… lasparaginylvalylarginylphenylalanylgl… alanylglycylarginylglutamylisoleucylty… einylserylisoleucylarginylserylserylly… glutamylisoleucylleucylarginylthreonyl… ylglycylglutamyltyrosylthreonylcystein… yltyrosylglycylserylvalylserylcysteiny… ylvalylthreonylvalylprolylglycylglycyl… leucylleucylprolylglutamylarginyllysyl… utamylvalylvalylleucyllysylserylvalyll… mylglutamylglutamylglutamylprolyllysyl… glutamyllysylvalyllysyllysylprolylalan… olylprolyllysylprolylvalylglutamylglut… lvalylthreonyllysylarginylglutamylargi… ylthreonyllysylvalylprolylglutamylisol… ylleucylprolylalanylprolylglutamylprol… nylglutamylvalyllysylthreonylisoleucyl… lprolylglutamylprolylthreonylprolyliso… ylvalylprolylvalylvalylglycyllysyllysy… lyllysylglutamylglutamylalanylalanylly… lysylglycylvalylprolyllysyllysylthreon… lalanylglutamylarginylarginyllysylleuc… cylglutamyllysylprolylprolylaspartylgl… nyltyrosylglutaminylleucyllysylalanylv… lyllysylglutamylisoleucyllysylaspartyl… tamylserylglutamylphenylalanylvalylgly… lanylglutamylcysteinylleucylvalylseryl… hreonylthreonyltryptophylmethionyllysy… eucylarginylglutamylserylprolyllysylhi… lanylaspartylglycyllysylaspartylarginy… cylaspartylvalylglutaminylleucylseryla… hreonylcysteinylvalylleucylarginylleuc… ylthreonylserylthreonylalanyllysylleuc… rolylvalylarginylphenylalanylvalyllysy… amylvalylthreonylvalylvalyllysylglycyl… serylcysteinylglutamylleucylasparaginy… alyltryptophylarginyllysylaspartylglyc… ysylprolylglycylarginylisoleucylvalylp… ylmethionylarginylalanylleucylthreonyl… spartylaspartylthreonylaspartylalanylg… reonylvalylglutamylasparaginylalanylas… ysteinylserylserylcysteinylvalyllysylv… nylaspartyltryptophylleucylvalyllysylp… inylhistidylvalyllysylprolyllysylglycy… lalanylcysteinylaspartylisoleucylalany… inylisoleucyllysyltryptophylphenylalan… lisoleucylprolylalanylglutamylprolylas… mylisoleucylleucylarginylaspartylglycy… ucyllysylisoleucyllysylasparaginylalan… oleucylalanylglutamyltyrosylalanylvaly… ylarginyltyrosylprolylalanyllysylleucy… lglutamylvalylglutamylleucylleucyllysy… ylthreonylisoleucyltyrosylglutamyllysy… ylaspartylalanylglutamylisoleucylseryl… ylglycylglutaminyltryptophyllysylleucy… inylprolylserylprolylthreonylcysteinyl… lglycylglycyllysylarginylphenylalanyll… yllysylleucylaspartylglutaminylalanylg… aminylalanylleucylasparaginylalanyliso… ylleucylthreonylvalyllysylglutamylisol… anylalanylvalylprolylleucyllysylaspart… rginylarginylglutaminylalanylarginylph… cylthreonylarginylglutamylalanylaspara… ysylglycylprolylaspartylisoleucylisole… nylalanylaspartylisoleucylisoleucylala… isoleucylleucylvalylisoleucylasparagin… ylaspartylaspartylglutamylglycylvalylt… utamylglycyllysyllysylthreonylserylala… reonylglycylisoleucylarginylleucyllysy… ucylglutamylaspartylglutaminylthreonyl… eonylalanylthreonylphenylalanylvalylcy… lutamyllysylmethionylhistidylvalylvaly… inylaspartylalanyllysylleucylhistidylt… cylisoleucylserylserylglutamylglycylly… mylmethionyllysylglutamylvalylthreonyl… lglutaminylisoleucyllysylalanylglutami… ylthreonylalanylglutaminylleucyllysylv… lyltyrosylphenylalanylthreonylvalyllys… ylalanylvalylglutamyllysylaspartylglut… teinylglutamylvalylseryllysylaspartylv… lalanyllysylaspartylglycylglutamylglut… lysyltyrosylserylisoleucyllysylalanyla… oleucylleucyllysylisoleucyllysyllysyla… ylglycylglutamyltyrosylvalylcysteinyla… tyllysylthreonyllysylalanylasparaginyl… inylleucylisoleucylglutamylvalylglutam… ylglutamylvalylphenylalanylvalylglycyl… lalanylglutamylisoleucylglutamylleucyl… tidylglycylglutaminyltryptophyllysylle… ylthreonylalanylserylprolylaspartylcys… tamylaspartylglycyllysyllysylhistidyli… ylasparaginylcysteinylglutaminylleucyl… ylvalylserylphenylalanylglutaminylalan… alanylalanylasparaginylleucyllysylvaly… leucylphenylalanylisoleucylthreonylpro… ylphenylalanylglutamyllysylaspartylglu… lcysteinylglutamylvalylserylarginylglu… larginyltryptophylleucyllysylglycylthr… eonylglycylaspartylaspartylarginylphen… laspartylglycylthreonyllysylhistidylse… lalanylalanylphenylalanylglutamylaspar… nylphenylalanylglutamylalanylglutamyla… ycyllysylleucylisoleucylisoleucylgluta… lphenylalanylleucylthreonylprolylleucy… sylglutamyllysylglutamylserylalanylval… leucylserylhistidylaspartylasparaginyl… lphenylalanyllysylasparaginylaspartylg… nylthreonylarginylserylvalylserylmethi… llysylthreonylhistidylserylisoleucylth… ylserylisoleucylaspartylaspartylthreon… lylglutamylalanylmethionylglycylmethio… cylthreonylvalylleucylglutamylglycylas… onylglycyllysylleucylglutaminylasparty… lysylaspartylglutamylvalylisoleucylleu… ucylseryllysylalanylaspartylalanylprol… ysylaspartylglycyllysylglutamylisoleuc… lanylvalylisoleucyllysylthreonylaspart… eucylisoleucylleucyllysyllysylalanylle… ylglutaminyltyrosylthreonylcysteinylas… yllysylthreonylserylglycyllysylleucyla… inylglutamylisoleucyllysylleucylvalyla… lglutamylvalylmethionylglutamylthreony… lalanylglutamylthreonylglutamylisoleuc… eucylhistidylalanylasparaginyltryptoph… nylleucylleucylglutaminylthreonylproly… lysylglutamylglutamylglycyllysylisoleu… stidylasparaginylcysteinylarginylleucy… ycylvalylaspartylphenylalanylglutaminy… erylserylalanylhistidylleucylarginylva… glycylleucylleucylarginylprolylleucyll… nylalanylglycylglutamylthreonylalanylt… lglutamylleucylseryltyrosylglutamylasp… yptophyltyrosylleucyllysylglycyllysyll… yllysylvalylvalylprolylarginylserylglu… ylleucylthreonylleucylarginylaspartylv… ylglycylglutamylvalylglutaminylleucylt… nyllysylthreonylhistidylalanylasparagi… amylprolylprolylvalylglutamylphenylala… laspartylglutaminylthreonylvalylglutam… lvalylleucylglutamylcysteinylglutamylv… alanyllysylvalyllysyltryptophylphenyla… glutamylisoleucylleucyllysylseryllysyl… lanylaspartylglycylarginylvalylarginyl… partylcysteinylthreonylprolylglutamyla… lthreonylcysteinylaspartylalanyllysyla… ylcysteinylasparaginylleucylasparaginy… lglutamylphenylalanylleucylarginylprol… minylvalylarginylglutamyllysylglutamyl… lutamylcysteinylglutamylleucylserylarg… alyllysyltryptophylphenylalanyllysylas… lysyllysylglycyllysyllysyltyrosylaspar… ylalanylvalylarginylisoleucylleucylval… lleucylleucylaspartylaspartylglutamyla… lutamylvalylarginylthreonylalanylargin… lthreonylvalylleucylglutamylglutamylgl… yllysylasparaginylleucylalanylasparagi… mylthreonylaspartylthreonylisoleucylly… lseryllysylprolylglycylalanylglutamylv… glycylaspartylglutamylglutamylisoleucy… inyltyrosylglutamylisoleucylleucylthre… ylisoleucylleucylvalylisoleucylglutami… lutamylaspartylalanylglycylasparaginyl… eucylprolylserylserylarginylthreonylas… tidylglutamylleucylalanylalanylglutamy… lylglutaminylasparaginylleucylglutamyl… yllysylalanylglutamylphenylalanylvalyl… utamylserylphenylalanylprolylvalylglut… laspartyllysylthreonylleucylglutamylse… ylvalylisoleucylalanylaspartylglycylly… llysylaspartylalanylthreonylleucylglut… yltyrosylvalylvalylmethionylvalylglycy… nylhistidylleucylthreonylvalylisoleucy… lvalylvalylprolylleucyllysylaspartylth… aminylglutaminylglutamylvalylvalylphen… lvalylasparaginylthreonylglutamylglycy… enylalanylarginylasparaginylglutamylgl… partylserylseryllysyltyrosylisoleucyli… ylleucylvalyltyrosylthreonylleucylargi… stidylleucylaspartylaspartylglutaminyl… valylserylleucylthreonylasparaginylhis… ylvalyllysylserylalanylalanylasparagin… mylglutamylaspartylleucylarginylisoleu… partylisoleucylglutamylthreonylmethion… nylphenylalanyltryptophylcysteinyllysy… aginylvalylthreonylleucyllysyltryptoph… tamylglutamylvalylprolylphenylalanylas… yrosylarginylvalylaspartyllysyltyrosyl… lisoleucyllysylaspartylcysteinylglycyl… lycylglutamyltyrosylisoleucylvalylthre… ysylserylvalylalanylglutamylleucylleuc… rolylthreonylglutamylphenylalanylvalyl… tylglutaminylthreonylvalylthreonylglut… nylvalylphenylalanylserylcysteinylglut… ylalanylasparaginylvalyllysyltryptophy… inylglutamylisoleucyllysylglutamylglyc… lglutamyllysylaspartylglycylserylisole… soleucyllysylaspartylcysteinylarginyll… nylglutamyltyrosylalanylcysteinylglycy… erylarginylalanylarginylleucylphenylal… rolylvalylglutamylisoleucylisoleucylar… isoleucylleucylglutamylalanylprolylgly… anylleucylalanylglutamylleucylasparagi… alylglutaminyltryptophylleucylarginyla… valylvalylglutaminylglycylaspartyllysy… ylserylglutamylglycyllysylisoleucylhis… ylcysteinylaspartylisoleucyllysylproly… tamyltyrosylarginylphenylalanylisoleuc… lanylarginylalanyllysylleucylglutamyll… soleucyllysylthreonylalanylaspartylglu… rtylvalylglycyllysylprolylleucylthreon… spartylalanyltyrosylprolyllysylalanylg… ylalanyllysylglutamylasparaginylglutam… eonylisoleucylaspartylthreonylthreonyl… ylphenylalanylarginylisoleucylleucylgl… llysylglycylarginyltyrosyllysylisoleuc… ysylhistidylglycyllysylalanylglutamylg… ylleucyllysylvalylisoleucylaspartylval… araginylleucylglutamylvalylthreonylglu… ycylglutamylvalylserylleucylalanyltryp… hreonylaspartylglycylglycylseryllysyli… valylglutamylarginylarginylaspartyliso… tophylvalylleucylalanylthreonylasparty… lglutamylphenylalanylthreonylvalylthre… ylglycylvalylglutamyltyrosylleucylphen… nylasparaginylarginylvalylglycylthreon… threonylaspartylasparaginylprolylvalyl… sylaspartylvalylprolylglycylprolylprol… leucylthreonylaspartylvalylasparaginyl… leucylthreonyltryptophylglutamylprolyl… glycylalanylglutamylisoleucylthreonyla… amylleucylarginylaspartyllysylthreonyl… rtylthreonylalanylmethionylthreonylval… ylserylalanylthreonylvalylthreonylaspa… nylglutamyltyrosylserylphenylalanylarg… araginylarginylisoleucylglycylvalylgly… onylprolylphenylalanylvalyllysylvalyla… larginylprolylserylprolylprolylvalylas… partylglutaminylthreonylglutaminylsery… ptophylglutamylprolylprolylleucyllysyl… eucylleucylglycyltyrosylisoleucylisole… lglutamylglycyllysylaspartylasparaginy… lasparaginylmethionyllysylleucylvalylp… ysylvalylthreonylglycylleucylglutamyll… ucyltyrosylarginylvalylserylalanylglut… ylserylaspartylprolylserylglutamylisol… ylalanylaspartylaspartylalanylphenylal… ionylaspartylleucylserylalanylphenylal… ylvalylisoleucylvalylprolylasparaginyl… cylvalylprolylserylthreonylglycyltyros… threonyltryptophylcysteinylphenylalany… amylthreonylglycylaspartylarginylvalyl… rylalanyltyrosylalanylglutamylleucylva… larginylserylaspartyllysylglycylisoleu… glutamylasparaginylarginylvalyllysylth… soleucylaspartylvalylasparaginylvalyli… nylprolyllysylglutamylleucyllysylpheny… nyllysylaspartylserylvalylhistidylleuc… rolylaspartylaspartylaspartylglycylgly… yrosylvalylvalylglutamyllysylarginylgl… ltryptophylthreonyllysylvalylmethionyl… partylleucylglutamylphenylalanylthreon… taminylglycyllysylglutamyltyrosylleucy… nylarginylasparaginyllysylcysteinylgly… tyrosylvalylaspartylglutamylprolylvaly… rolylalanylthreonylvalylprolylaspartyl… llysyltryptophylarginylaspartylarginyl… ucylphenylalanylleucylthreonyltryptoph… nylaspartylglycylglycylserylarginyliso… lylglutamylarginylcysteinylprolylargin… lvalylalanylcysteinylglycylglutamylpro… methionylglutamylvalylthreonylglycylle… tophyltyrosylalanyltyrosylarginylvalyl… ylglutaminylglycylalanylseryllysylprol… lglutamylisoleucylglutaminylalanylvaly… alanylprolylglutamylisoleucylphenylala… ucylalanylglycylleucylthreonylvalyllys… lglutamylleucylprolylalanylthreonylval… prolyllysylisoleucylthreonyltryptophyl… lisoleucylleucyllysylglutaminylasparty… ucylglutamylasparaginylvalylprolyllysy… leucylvalylaspartylseryllysylarginylse… rosylisoleucylisoleucylglutamylalanylv… arginylalanylthreonylalanylvalylvalylg… spartyllysylprolylglycylprolylprolylal… ucylthreonylaspartylvalylthreonylaspar… eucylthreonyltryptophylasparaginylprol… ylglycylseryllysylisoleucylthreonylasp… ginylarginylalanylthreonylaspartylsery… ylleucylserylserylthreonylvalyllysylas… yllysylalanylthreonyllysylleucylisoleu… rosylisoleucylphenylalanylarginylvalyl… ionyltyrosylglycylalanylglycylglutamyl… lylisoleucylthreonylalanyllysyltyrosyl… lprolylglycylprolylprolylthreonylargin… isoleucylthreonyllysylaspartylalanylva… cysteinylglutamylprolylaspartylasparty… leucylthreonylglycyltyrosyltryptophylv… olylaspartylthreonylaspartyllysyltrypt… yllysylmethionylprolylvalyllysylaspart… yllysylglycylleucylthreonylasparaginyl… alanylarginylvalylleucylalanylglutamyl… glycyllysylprolylseryllysylserylthreon… eucyllysylaspartylprolylisoleucylaspar… ylglycyllysylprolylthreonylvalyllysyla… lvalylarginylleucylasparaginyltryptoph… ylaspartylglycylglycylalanyllysylisole… cylglutamylmethionylleucyllysylthreony… tophylvalylarginylvalylalanylglutamylg… taminylhistidylleucylleucylprolylglycy… minylglutamyltyrosylserylphenylalanyla… ginyllysylalanylglycylglutamylserylglu… aspartylprolylvalylleucylcysteinylargi… prolylserylprolylprolylarginyltryptoph… aginylisoleucylthreonyllysylasparaginy… ryptophylthreonylvalylprolylglutamylly… soleucylthreonylasparaginyltyrosylisol… tylvalylarginylarginyllysylglycyltrypt… lthreonylthreonylvalyllysylaspartylthr… eonylprolylleucylthreonylglutamylglycy… larginylvalylalanylalanylglutamylaspar… ylserylaspartyltyrosylthreonylglutamyl… leucylalanyllysylaspartylthreonylpheny… prolylprolyltyrosylalanylleucylalanylv… arginylhistidylvalylaspartylleucyllysy… lasparaginylaspartylglycylglycylarginy… rosylvalylisoleucylglutamyllysyllysylg… rginyltryptophylvalyllysylalanylglycyl… rtylcysteinylasparaginylphenylalanylar… eucylglutamylglycylthreonylglutamylval… alylarginylalanylglutamylasparaginylgl… ylprolylserylglutamylprolylthreonylglu… lutamylaspartylprolylthreonylserylprol… rtylleucylhistidylvalylthreonylasparty… oleucylalanylisoleucylalanyltryptophyl… aginylglycylglycylserylprolylisoleucyl… glutamylmethionylcysteinylprolylvalylg… lmethionylarginylvalylasparaginylseryl… leucyllysylphenylalanyllysylvalylgluta… partyllysylglutamyltyrosylvalylleucyla… ginylalanylisoleucylglycylvalylserylgl… erylglutamylasparaginylvalylvalylalany… yllysylprolylthreonylisoleucylaspartyl… tylisoleucylisoleucylvalylisoleucylglu… isoleucylprolylvalylprolylphenylalanyl… threonylvalylseryltryptophylhistidylly… lysylalanylserylaspartylarginylleucylt… artylhistidylisoleucylserylalanylhisti… rylvalylarginylalanylaspartylalanylgly… lthreonylleucylglutamylasparaginyllysy… nylserylisoleucylasparaginylvalyllysyl… cylprolylcysteinyllysylaspartylisoleuc… threonyllysylserylserylcysteinyllysyll… ylprolylglutamylphenylalanylaspartylgl… ucylhistidyltyrosylvalylleucylglutamyl… rginylarginylthreonyltyrosylisoleucylp… mylasparaginyllysylleucylseryltryptoph… soleucylprolylasparaginylglycylglutamy… inylvalyllysylalanylvalylasparaginylly… yrosylisoleucylglutamylleucyllysylaspa… utaminylaspartylprolyllysylglutaminylp… laspartylvalylglutamylvalylhistidylasp… lalanylmethionylthreonylisoleucylthreo… ltyrosylaspartylglycylglycylseryllysyl… eucylisoleucylglutamyllysylisoleucylal… nyltryptophyllysylarginylcysteinylaspa… rolylisoleucylleucylthreonyltyrosylthr… lglutamylglycyllysylglutamyltyrosylglu… nylalanylglutamylasparaginylalanylalan… lserylarginylalanylthreonylprolylproly… olylisoleucylaspartylalanylprolyllysyl… serylleucylglutamylvalyllysylarginylgl… leucylaspartylalanylserylisoleucylsery… onylisoleucylthreonyltryptophylisoleuc… alylisoleucylvalylprolylglutamylglutam… lanylprolylleucylvalylarginylarginylar… inylglutamylglutamylglutamylprolylphen… onylglutaminylarginylleucylserylisoleu… ylglycylglutamylserylglutaminylleucyla… ylarginylprolylaspartylhistidylglycyll… valylglutamylasparaginylaspartylhistid… rolylcysteinylthreonylvalylserylvalyll… olylprolylisoleucylasparaginylphenylal… ylisoleucylarginyllysylthreonylserylva… utamylprolylprolylleucylaspartylaspart… lisoleucylasparaginyltyrosylthreonylle… threonyllysylprolylaspartylserylglutam… onylserylthreonylleucylarginylhistidyl… onyllysylleucylisoleucylglutamylglycyl… nylarginylvalylarginylalanylglutamylas… rolylglycylprolylprolylcysteinylvalyls… ylaspartylprolylphenylalanylglycylprol… llysylprolylisoleucylvalylglutamylaspa… rylmethionylleucylvalyllysyltryptophyl… tylasparaginylglycylserylprolylisoleuc… ylglutamyllysylarginylglutamylvalylasp… phylserylarginylvalylasparaginyllysyls… ucyllysylalanylasparaginylvalylasparty… ucylthreonyltyrosylvalylphenylalanylar… paraginylalanylalanylglycylprolylglycy… serylaspartylprolyllysylthreonylalanyl… lprolylprolylglycylprolylprolylisoleuc… lthreonylserylserylthreonylthreonyliso… hylglutamylprolylprolylalanylphenylala… tamylisoleucylvalylglycyltyrosylphenyl… eucylvalylglycylthreonylasparaginyllys… reonylglutamyllysylmethionylisoleucyll… reonylvalyllysylglutamylisoleucylargin… yllysylleucylarginylvalylserylalanylva… tamylglycylprolylprolylglycylglutamylt… lvalylalanylglutamylprolylglutaminylgl… ylleucylaspartylvalylserylvalyllysylgl… cylmethionylalanylglycyllysylthreonyll… lylvalylthreonylglycylarginylprolylval… lthreonyllysylglutamylglutamylglycylgl… ginylvalylvalylisoleucylaspartylaspara… lutamylleucylisoleucylisoleucyllysylas… tylhistidylglycylarginyltyrosylvalylis… ginylserylcysteinylglycylseryllysylphe… alylglutamylvalylphenylalanylaspartylv… partylleucyllysylprolylvalylvalylthreo… cysteinylleucylleucylasparaginyltrypto… rtylaspartylglycylglycylserylglutamyli… soleucylisoleucylglutamylarginyllysyla… threonyltryptophylarginylglutaminylpro… larginylseryllysylcysteinylaspartyliso… tamylglycylglutaminylglutamyltyrosylly… lalanyllysylasparaginyllysylphenylalan… valylglutamylisoleucylglycylprolylisol… lleucylglycylprolylprolylthreonylseryl… tyrosylthreonylglutamylarginylglutamin… onylleucylaspartyltryptophyllysylgluta… cylglycylserylprolylisoleucylglutaminy… tamyllysylarginylarginylhistidylaspart… utamylarginylvalylasparaginyllysylargi… eonylserylphenylalanylleucylvalylgluta… lhistidylglutaminylmethionyltyrosylglu… lanylvalylasparaginylglutamylisoleucyl… rylleucylprolylleucylasparaginylvalylv… rtylglutamylvalylprolylprolylthreonyli… ylvalylarginylglycylaspartylthreonylis… lutamylprolylvalylhistidylisoleucylpro… lleucylprolylmethionylprolyllysylisole… araginylglutamylthreonylvalylisoleucyl… alanylleucylglutaminylisoleucylthreony… inylserylglutamylalanyllysylthreonylgl… ylalanylvalylarginylglutamylaspartylly… ylthreonylalanylserylasparaginylarginy… arginylasparaginylvalylhistidylvalylgl… olylserylprolylprolylarginylasparaginy… soleucyllysylalanylglutamylserylcystei… spartylalanylprolylleucylaspartylaspar… eucylthreonylhistidyltyrosylvalylisole… nylserylarginyllysyllysylalanylglutamy… eonylasparaginylthreonylalanylvalylglu… ucyltryptophyllysylleucylisoleucylprol… lglutamylphenylalanylarginylvalylargin… lglycylisoleucylserylaspartylglutamylc… lvalylisoleucylglutaminylaspartylproly… olylprolylglycyllysylprolyllysylvalyll… ylserylmethionylleucylvalylseryltrypto… tylasparaginylglycylglycylserylprolyli… phylleucylglutamyllysylarginylglutamyl… ptophylserylarginylvalylserylarginylal… ylglycylleucyllysylglycylvalylglutamyl… rginylleucylleucylglutamylglycylvalyll… ginylalanylmethionylalanylisoleucylasp… glycylprolylprolylserylglutamylprolyls… ylglycylaspartylprolylisoleucylphenyla… serylcysteinylprolylglutamylvalyllysyl… lisoleucylserylleucylglycyltryptophyll… glycylglycylserylprolylisoleucyllysylg… ethionylglutaminylglutamylglutamylglyc… llysylarginylvalylasparaginylglutamylp… reonylthreonylcysteinylglutamylcystein… lysylglutamylleucylarginyllysyltyrosyl… lalanylvalylasparaginylglutamylalanylg… ylaspartylthreonylthreonylglycylglutam… rtylisoleucylglutaminylglutamylglutamy… leucylaspartylisoleucylglycylalanylglu… cysteinyllysylalanylglycylserylglutami… lanylvalylisoleucyllysylglycylarginylp… ryptophylglutamylphenylalanylaspartylg… hionyllysylaspartylglycylvalylhistidyl… rtylalanylglutaminylleucylglutamylthre… erylvalylisoleucylisoleucylisoleucylpr… rylhistidylthreonylglycyllysyltyrosyls… araginyllysylalanylglycylglutaminyllys… larginylvalyllysylvalylmethionylaspart… laspartylleucyllysylvalylserylaspartyl… cysteinylarginylleucylseryltryptophyll… aspartylglycylglycylaspartylarginyliso… cylglutamyllysylarginylthreonylisoleuc… ylthreonyllysylvalylasparaginylprolyla… threonylphenylalanylvalylvalylprolylas… aminylglutaminyltyrosylphenylalanylphe… lutamylasparaginylarginylphenylalanylg… ylglutamylthreonylisoleucylglutaminyla… aspartylprolylisoleucyltyrosylprolylpr… sylleucyllysylisoleucylglycylleucyliso… nylvalylhistidylleucylseryltryptophyll… artylglycylglycylserylprolylvalylthreo… tamylcysteinylleucylalanyltryptophylas… ysyllysylglutamylalanyltryptophylargin… ylarginylaspartylvalylglutamylglutamyl… lvalylglutamylaspartylleucylvalylgluta… mylphenylalanylarginylvalyllysylalanyl… alylseryllysylprolylserylalanylthreony… cysteinylglutaminylarginylprolylaspart… ylaspartylleucyllysylglutamylphenylala… utamylglycylthreonylasparaginylvalylas… soleucyllysylglycylvalylprolylphenylal… ptophylphenylalanyllysylalanylprolylpr… inyllysylglutamylprolylvalylleucyltyro… araginyllysylleucylvalylvalylaspartyla… cylvalylisoleucylprolylglutaminylseryl… glycylleucyltyrosylthreonylisoleucylth… inylleucylglycylthreonylalanylseryllys… araginylvalylleucylglycylarginylprolyl… isoleucyllysylphenylalanylglutamylsery… methionylthreonylleucylseryltryptophyl… ylaspartylglycylglycylseryllysylisoleu… soleucylglutamyllysylarginylglutamylal… tryptophylvalylhistidylvalylserylseryl… lthreonyltyrosylthreonylisoleucylproly… tidylglutamyltyrosylvalylphenylalanyla… minylasparaginyllysyltyrosylglycylisol… rtylserylglutamylprolylglutamylthreony… ylalanylserylvalylprolylglycylalanylpr… lserylserylvalylthreonylarginylasparag… raginyltryptophylglutamylglutamylproly… lserylprolylvalylthreonylglycyltyrosyl… sylaspartylthreonylthreonylseryllysyla… paraginylarginylaspartylprolylisoleucy… glycylvalylseryltyrosyllysylvalylthreo… cylserylaspartyltyrosylglutaminylpheny… leucylasparaginylalanylalanylglycylval… ylserylaspartylprolylalanylthreonylala… anylprolylprolylglycylprolylprolylphen… artyltryptophylthreonyllysylserylseryl… hylserylprolylprolylleucyllysylasparty… lglycyltyrosylisoleucylvalylglutamylty… ylglutamylglutamyltryptophylglutamylly… valylarginylglycylthreonyllysylleucylv… lutamylglycylalanylphenylalanyltyrosyl… lanylvalylasparaginylisoleucylalanylgl… ycylglutamylvalylthreonylaspartylvalyl… rtylarginylleucylvalylserylprolylaspar… anylserylvalylarginylaspartylarginylis… ylglycylvalylisoleucylarginylisoleucyl… cyllysylprolylprolylprolylthreonylvaly… onylasparaginylglutamylarginylthreonyl… lthreonylisoleucylglutamylthreonylthre… ethionylvalylisoleucyllysylasparaginyl… idylglutaminylglycylvalyltyrosylseryll… utamylalanylglycylglutamylarginyllysyl… laspartylvalylleucylaspartylvalylproly… lylphenylalanylleucylalanylhistidylasp… utamylserylcysteinyllysylleucylthreony… lutamylaspartylaspartylglycylglycylser… ltyrosylvalylisoleucylglutamyllysylarg… inylalanyltryptophylthreonylprolylvaly… ylarginylglutaminylasparaginylalanylth… oleucylglutaminylglycyllysylalanyltyro… soleucylalanylalanylglutamylasparaginy… lprolylphenylalanylvalylglutamylthreon… leucylarginylglutamylprolylisoleucylth… lylglutamylaspartylleucylglutamylvalyl… raginylthreonylvalylthreonylleucylthre… yllysyltyrosylaspartylglycylglycylsery… nyltyrosylvalylleucylglutamylserylargi… tamyllysylphenylalanylhistidyllysylval… ginylleucylleucylserylarginyllysyltyro… sylglutamylglycylaspartylthreonyltyros… lanylvalylasparaginylisoleucylvalylgly… phenylalanylcysteinylthreonyllysylprol… partylglutamylleucylalanylprolylprolyl… lphenylalanylarginylaspartyllysylleucy… lglutamylalanylphenylalanylalanylleucy… lycyllysylprolyllysylprolyllysylvalyls… rtylglutamylalanylaspartylvalylleucylg… nylhistidylisoleucyllysylthreonylthreo… leucylglutamyllysylisoleucyllysylalany… yllysyltyrosylcysteinylvalylvalylvalyl… cylserylarginyllysylglycylphenylalanyl… valylvalylaspartylhistidylprolylglycyl… erylphenylalanylaspartylglutamylvalylt… lvalylisoleucylseryltryptophyllysylpro… ylglycylseryllysylisoleucylthreonylasp… utamyllysyllysylglutamylvalylglycyllys… rolylvalylthreonylserylalanylserylalan… ylvalylseryllysylleucylleucylglutamylg… henylalanylarginylisoleucylhistidylala… glycylisoleucylserylaspartylprolylleuc… ysylalanyllysylaspartylarginylphenylal… lprolylaspartylglutaminylprolylisoleuc… llysylaspartylserylalanylleucylvalylth… lylhistidylaspartylglycylglycyllysylpr… osylisoleucylleucylglutamyllysylarginy… larginyltryptophylalanylarginylvalylth… istidylprolyltyrosylthreonyllysylpheny… ucylleucylglutamylglycylcysteinylgluta… inylvalylserylalanylglutamylasparaginy… ycylaspartylprolylserylprolylprolylser… llysylaspartylprolylisoleucylalanyllys… aginylprolylglutamylalanylisoleucylasp… aginylserylvalylaspartylleucylthreonyl… inylhistidylaspartylglycylglycylseryll… leucylvalylglutamyltyrosylglutaminylly… myltryptophylarginylarginylalanylaspar… lserylcysteinylprolylglutamylthreonyll… leucylarginylaspartylglycylglutaminylt… nylvalylleucylalanylvalylasparaginylal… ylprolylalanylhistidylvalylprolylgluta… tylarginylleucylglutamylprolylprolylgl… alanylasparaginylmethionylalanylarginy… llysylvalylglycylaspartylthreonylleucy… soleucyllysylglycylvalylprolylphenylal… hyllysyllysylglutamylaspartylarginylas… ylarginylisoleucylaspartylvalylthreony… lutamylisoleucylarginylasparaginylalan… cylglycylisoleucyltyrosylserylleucylth… lalanylglycylseryllysylthreonylvalylse… aspartyllysylprolylglycylprolylprolyla… rylglutamylisoleucylarginyllysylaspart… yltryptophyllysylglutamylprolylleucyla… ylisoleucylthreonylasparaginyltyrosylv… rtylvalylalanylserylalanylglutaminyltr… lthreonylseryllysyllysyllysylserylhist… leucylasparaginylglutamylglycylasparag… anylarginylvalylalanylalanylglutamylas… inylglycylprolylphenylalanylvalylgluta… yllysylalanylleucylaspartylprolylleucy… olyllysylaspartylleucylhistidylhistidy… eonylglutamylvalylserylleucylvalyltryp… larginylaspartylglycylglycylserylproly… ylvalylglutamyltyrosylglutaminylglutam… spartyltryptophylisoleucyllysylphenyla… raginylleucylglutamylcysteinylvalylval… taminylglycyllysylthreonyltyrosylargin… ylglutamylasparaginylisoleucylvalylgly… threonylthreonylisoleucylprolylisoleuc… yllysylleucylvalylprolylprolylserylval… eucylisoleucylglutamylglycylleucylvaly… onylvalylarginylphenylalanylprolylalan… lylprolylvalylprolylthreonylalanyllysy… glycylserylglutamylisoleucyllysylthreo… hreonylvalylglutamylthreonylaspartylas… lleucylthreonylisoleucyllysylasparagin… rtylthreonylglycylglutamyltyrosylgluta… araginylalanylalanylglycylseryllysylth… lthreonylvalylleucylaspartylvalylproly… olylisoleucylasparaginylisoleucylleucy… lhistidylmethionylthreonylisoleucylser… ysylaspartylaspartylglycylglycylserylp… ylisoleucylvalylglutamyllysylglutaminy… ylthreonyltryptophylglycylvalylvalylse… yllysylleucyllysylisoleucylprolylhisti… inylglutamyltyrosylvalylphenylalanylar… raginyllysylisoleucylglycylvalylglycyl… onylprolylthreonylvalylalanyllysylhist… lylserylprolylprolylglycyllysylprolylv… hreonylglutamylasparaginylalanylalanyl… lleucylprolyllysylserylaspartylglycylg… ycyltyrosyltyrosylmethionylglutamylarg… cyllysyltryptophylvalylarginylvalylasp… lalanylaspartylleucyllysylphenylalanyl… osylglutamylglycylasparaginylthreonylt… lylphenylalanylalanylglutamylasparagin… lprolylserylprolylserylserylaspartylpr… ginylprolylisoleucyllysylprolylprolylg… ylprolyllysylleucyllysylaspartyllysyls… partylleucylvalyltryptophylthreonyllys… ycylserylprolylisoleucylleucylglycylty… taminyllysylprolylglycylthreonylalanyl… nylisoleucylasparaginyllysylaspartylgl… nylcysteinylalanylphenylalanylarginylv… amylglycylasparaginylglutamyltyrosylar… sylalanylalanylasparaginylisoleucylval… larginylglutamylleucylalanylglutamylse… lisoleucylleucylhistidylprolylprolylgl… lylthreonylcysteinylarginylaspartylval… lglycylglutaminylthreonylisoleucylargi… llysylglycylarginylprolylglutamylproly… lthreonyllysylglutamylglycyllysylvalyl… nylvalylaspartylleucylisoleucylglutami… glutamylleucylglutaminylisoleucyllysyl… artylhistidylglycyllysyltyrosylisoleuc… nylserylserylglycylhistidylalanylgluta… lasparaginylvalylleucylaspartylarginyl… ylasparaginylleucyllysylvalylthreonyla… lasparaginylcysteinylthreonylisoleucyl… rolylleucylaspartylasparaginylglycylgl… sparaginylphenylalanylisoleucylvalylgl… raginylglutaminyllysylglycyltryptophyl… tylvalylthreonyllysylarginylleucylisol… ucylalanylasparaginylasparaginylglutam… valylcysteinylalanylglutamylasparaginy… hreonylisoleucylglutamylthreonyllysylt… soleucylasparaginylprolylisoleucylaspa… ylglutamylasparaginylleucylhistidyliso… lthreonylphenylalanylvalyltyrosylleucy… laspartyltyrosylaspartylglycylglycylse… sylhistidylvalylglutamylarginylarginyl… tyltryptophylglutamylarginylvalylhisti… utamylthreonylhistidyltyrosylmethionyl… lutamylasparaginylglutaminylisoleucylt… lylglutaminylthreonyllysylasparaginylg… artyltryptophylvalyllysylthreonylgluta… amylaspartylleucylglutaminyllysylproly… ylserylglycylvalylleucylthreonylvalyll… leucylarginylleucylglutamylalanylglycy… lalanylprolylglutamylvalylalanyltrypto… tylalanylthreonylaspartylleucylthreony… lisoleucylaspartylthreonylarginylalany… lserylleucylthreonyllysylalanyllysylar… tyrosylvalylvalylthreonylalanylthreony… ylphenylalanylvalylalanyltyrosylalanyl… aspartyllysylprolylglycylprolylvalylar… lvalylaspartylvalylserylserylaspartyla… yltryptophylaspartylprolylprolylglutam… inylglutamylisoleucylglutaminylasparag… ysylcysteinylglutamylthreonyllysylargi… eonyltyrosylserylalanylthreonylvalylle… eonylvalylthreonylarginylleucylisoleuc… tyrosylisoleucylphenylalanylarginylval… ysylisoleucylglycylthreonylglycylproly… olylvalylisoleucylalanyllysylthreonyll… larginylprolylaspartylprolylprolylglut… ylglutamylglutamylmethionylthreonylval… rolylglutamyltyrosylaspartylglycylglyc… tyrosylphenylalanylleucylglutamyllysyl… onylarginyltryptophylvalylprolylvalyla… prolylglutamylarginylarginylmethionyll… lleucylprolylaspartylhistidylglutamylt… valyllysylalanylglutamylasparaginylglu… glutamylprolylserylleucylprolylserylar… artylprolylisoleucylglutamylprolylprol… inylphenylalanylarginylvalylvalylaspar… ylisoleucylthreonylleucylglycyltryptop… artylglycylglycylalanylprolylisoleucyl… tamylmethionylarginylprolyllysylisoleu… spartylglutamylglycyltryptophyllysylar… ylalanylglutaminylleucylvalylarginylly… lthreonylserylleucylaspartylglutamylas… lutamylphenylalanylarginylvalylcystein… inylvalylglycylisoleucylglycylarginylp… mylalanylisoleucyllysylprolyllysylglut… olylglutamylisoleucylaspartylleucylasp… ylleucylvalylisoleucylvalylarginylalan… inylleucylphenylalanylalanylisoleucylv… lprolyllysylvalylthreonyltryptophylarg… ylasparaginylvalylvalylarginyllysylgly… ylaspartylthreonylmethionylalanylpheny… paraginylserylthreonylarginylaspartyla… leucylthreonylleucylvalylasparaginylpr… valylphenylalanylvalylasparaginylvalyl… rolylglycylprolylvalylserylaspartylleu… onyllysylthreonylserylcysteinylhistidy… olylglutamylasparaginylaspartylglycylg… stidyltyrosylisoleucylvalylglutamyllys… nyllysylthreonyltryptophylserylthreony… syllysylthreonylserylphenylalanylhisti… lylprolylglycylasparaginylglutamyltyro… hreonylalanylvalylasparaginylglutamylt… threonylaspartylvalylprolyllysylprolyl… lleucylserylglutamylprolylaspartylprol… lanylthreonylglutamylmethionylthreonyl… leucylalanyltryptophylleucylprolylprol… alanyllysylisoleucylaspartylglycyltyro… ginylglutamylglutamylglutamylglutaminy… hylthreonylglutamyltyrosylserylvalylva… lylvalylthreonylglycylleucyllysylgluta… ylalanylarginylvalylalanylalanylarginy… erylleucylprolylarginylglutamylalanylg… anyllysylglutamylglutaminylleucylleucy… thionylprolylglutamylglutaminylisoleuc… llysyllysylleucylarginylisoleucylgluta… lysylprolylhistidylprolylthreonylcyste… glutamylaspartylglutamylvalylvalylthre… alylhistidyllysylalanylaspartylserylse… leucyllysylaspartylvalylthreonylarginy… osylserylleucylthreonylalanylglutamyla… spartylthreonylglutaminyllysylisoleucy… tylalanylprolylglycylprolylprolylgluta… ylisoleucylserylaspartylisoleucylaspar… ylleucylseryltryptophylhistidylisoleuc… lglycylserylasparaginylisoleucylthreon… lutamyllysylcysteinylaspartylvalylsery… ylthreonylalanylleucylalanylserylvalyl… arginylvalylglycyllysylleucylisoleucyl… ylisoleucylphenylalanylarginylvalylarg… lphenylalanylglycylisoleucylserylgluta… ysylmethionylvalylalanylglutaminylphen… ylprolylserylglutamylprolyllysylaspara… lvalylasparaginyllysylaspartylcysteiny… yptophylaspartylarginylprolylaspartyls… isoleucylisoleucylglycyltyrosylleucyli… larginylasparaginylserylleucylleucyltr… aspartylthreonylleucylvalylarginylsery… inylalanylglycylleucylvalylglutamylgly… alanylarginylisoleucyltyrosylalanylleu… lserylprolylprolylseryllysylprolylthre… nylarginylmethionylprolylvalylaspartyl… ylvalylisoleucylaspartylvalylthreonyll… oleucyltryptophylalanylarginylprolylly… llysylisoleucylisoleucylglycyltyrosylp… inyllysylleucylprolylglycylaspartyllys… paraginylthreonylalanylprolylhistidylg… lutamylglutamyltyrosylthreonylalanylth… ysylalanylglutaminyltyrosylglutaminylp… anylarginylthreonylalanylvalylasparagi… lutamylprolylserylaspartylprolylvalylt… lasparaginylvalylprolylprolylarginylis… ylmethionyllysylserylleucylleucylthreo… paraginylvalylcysteinylleucylaspartyla… llysylprolylmethionylprolylthreonylval… glycylthreonylleucylleucyllysylprolyla… thionylalanylmethionylglutaminylarginy… leucylglutamylleucylphenylalanylserylv… serylglycylaspartyltyrosylthreonylisol… nylserylserylglycylseryllysylserylalan… valylleucylaspartyllysylprolylglycylpr… eucylasparaginyllysylmethionyltyrosyls… eucylseryltryptophylglutamylprolylprol… lserylglutamylisoleucylthreonylasparag… sylarginylglutamylthreonylserylarginyl… utaminylvalylserylalanylthreonylvalylp… lserylvalylglutamyllysylleucylisoleucy… sylglutaminylphenylalanylarginylisoleu… yllysyltyrosylglycylvalylglycylasparty… tamylprolylalanylisoleucylalanyllysyla… ylprolylglycylarginylcysteinylaspartyl… raginylisoleucylthreonyllysylaspartylh… ryptophyllysylprolylprolylalanylaspart… oleucylthreonylglycyltyrosylleucylleuc… nylglutaminylalanylvalylasparaginyltry… larginyllysylprolylisoleucylisoleucylg… anylthreonylglycylleucylglutaminylglut… utamylphenylalanylarginylvalylthreonyl… ylglycylprolylglycyllysylprolylserylas… yrosylalanylarginylaspartylprolylgluta… lprolylalanylphenylalanylprolyllysylva… rginylserylserylvalylserylleucylserylt… osylaspartylglycylglycylserylprolyliso… alylglutamylvalyllysylarginylalanylasp… phylvalylarginylcysteinylasparaginylle… ylglutaminyllysylthreonylarginylphenyl… ucylmethionylglutamylaspartylthreonylg… nylarginylvalyltyrosylalanylvalylaspar… rylaspartylprolylserylaspartylvalylpro… yllysylaspartylisoleucylleucylisoleucy… histidylaspartylalanylaspartylleucylar… ucylarginylalanylglycylvalylthreonylme… lylvalyllysylglycylarginylprolylprolyl… hylseryllysylprolylasparaginylvalylasp… lisoleucylglycylleucylaspartylisoleucy… anylaspartylthreonylphenylalanylleucyl… valylasparaginyllysyltyrosylaspartylal… ylthreonylleucylglutamylasparaginylser… tyrosylthreonylisoleucylvalylvalyllysy… lycylprolylprolylisoleucylasparaginylv… ucylseryllysylaspartylserylalanyltyros… olylprolylisoleucylisoleucylaspartylgl… ucylasparaginyltyrosylvalylvalylglutam… mylarginyllysylseryltryptophylserylthr… ysteinylseryllysylthreonylserylphenyla… eucylglutamylglutamylglycyllysylserylt… ylvalylphenylalanylalanylglutamylaspar… lglycylaspartylprolylglycylglutamylthr… lalanylserylglutaminylthreonylprolylgl… ysylvalylarginylserylvalylseryllysylse… yltryptophyllysyllysylprolylhistidylse… isoleucylisoleucylglycyltyrosylvalylva… ylglutamylglutamylasparaginyllysyltryp… yllysylserylleucylserylleucylglutaminy… cylthreonylglutamylglycyllysylglutamyl… alylserylalanylglutamylasparaginylglut… threonylprolylserylglutamylisoleucylth… ylaspartylvalylvalylalanylprolylaspart… ucylprolylaspartylleucylcysteinyltyros… nylserylasparaginylphenylalanylarginyl… lysylglycyllysylprolylalanylprolylsery… ylglutamylaspartylprolylleucylalanylth… erylvalylglutamylserylserylalanylvalyl… oleucylvalyltyrosylaspartylcysteinylgl… cyllysyltyrosylthreonylisoleucylthreon… glycylthreonyllysylglutamylglycylthreo… lvalylglycyllysylprolylglycylisoleucyl… lysylphenylalanylaspartylglutamylvalyl… ylthreonylleucyllysyltryptophylalanylp… cylglycylserylglutamylisoleucylthreony… lutamyllysylarginylaspartylserylvalyla… lvalylthreonylcysteinylalanylserylalan… nylphenylalanylarginylvalylthreonylarg… hionylglutamyltyrosylthreonylphenylala… sparaginyllysyltyrosylglycylvalylglycy… amylprolylisoleucylvalylalanylarginylh… lylprolylaspartylalanylprolylprolylpro… spartylvalylarginylhistidylaspartylser… lthreonylaspartylprolyllysyllysylthreo… threonylglycyltyrosylhistidylleucylglu… ylasparaginylserylleucylleucyltryptoph… lthreonylprolylisoleucylarginylmethion… alylthreonylglycylleucylthreonylglutam… ylphenylalanylarginylvalylmethionylala… glycylvalylglycyllysylprolylserylleucy… lalanylleucylaspartylprolylisoleucylas… glutamylvalylisoleucylasparaginylisole… valylthreonylleucylisoleucyltryptophyl… spartylglycylglycylhistidyllysylleucyl… glutamyllysylarginylaspartylleucylprol… llysylalanylasparaginylhistidylvalylas… ylalanylphenylalanylthreonylvalylthreo… lglycyllysyltyrosylglutamylphenylalany… asparaginylthreonylalanylglycylalanyli… mylserylthreonylglutamylthreonylisoleu… lutamyltyrosylglutamylalanylprolylthre… lylthreonylisoleucyllysylaspartylglycy… glycylaspartylthreonylisoleucylvalylle… isoleucylleucylglycyllysylprolylleucyl… llysylalanylglycyllysylaspartylisoleuc… ylthreonylglutaminylisoleucylthreonyls… lmethionylleucylthreonylisoleucyllysyl… partylalanylglycylglutamyltyrosylthreo… sparaginylprolylphenylalanylglycylthre… lysylvalylthreonylvalylleucylaspartylv… rolylvalylglutamylisoleucylserylaspara… lanylthreonylleucylthreonyltryptophylt… partylglycylglycylserylprolylisoleucyl… tamyllysylarginylglutamylthreonylseryl… ylvalylvalylserylglutamylaspartylisole… histidylvalylalanylthreonyllysylleucyl… lglutamyltyrosylisoleucylphenylalanyla… nylhistidyltyrosylglycyllysylglycylglu… amylprolylvalyllysylmethionylvalylaspa… prolylglycylprolylprolylglutamyllysylp… alylthreonyllysylasparaginylthreonylal… ylarginylprolylvalylaspartylaspartylgl… eonylglycyltyrosylhistidylvalylglutamy… rylleucylarginyltryptophylvalylarginyl… alylserylaspartylleucylarginylcysteiny… aminylglutamylglycylserylthreonyltyros… erylalanylglutamylasparaginylarginylal… ylserylglutamylalanylserylaspartylsery… lanylalanyltyrosylprolylprolylglycylpr… tidylvalylthreonylaspartylthreonylthre… lalanyltryptophylglycyllysylprolylhist… ylglutamylisoleucylthreonylglycyltyros… nyllysylvalylglycylaspartylglutamylala… threonylthreonylglycylthreonylalanylle… nylphenylalanylvalylvalylprolylasparty… myllysyltyrosylasparaginylphenylalanyl… lasparaginylaspartylalanylglycylvalylg… ucylprolylaspartylvalylglutamylisoleuc… onylalanylprolylaspartylphenylalanylgl… eucylarginylarginylthreonylleucylvalyl… isoleucylarginylisoleucylphenylalanylv… ylprolylalanylprolylglutamylvalylthreo… sparaginylisoleucylasparaginylleucylly… nylisoleucylglutamylasparaginylthreony… eucylleucylisoleucylisoleucylprolylglu… osylaspartylthreonylglycyllysylphenyla… lglutamylasparaginylprolylalanylglycyl… lylasparaginylvalylarginylvalylleucyla… lylleucylasparaginylleucylarginylproly… ysylaspartylserylvalylthreonylleucylhi… lleucylisoleucylaspartylglycylglycylse… nyltyrosylisoleucylvalylglutamyllysyla… lysylseryltyrosylserylthreonylalanylth… llysylcysteinylthreonyltyrosyllysylval… glycylcysteinylglutamyltyrosylphenylal… ylalanylglutamylasparaginylglutamyltyr… olylthreonylglutamylthreonylthreonylgl… utamylalanylprolylserylprolylprolylasp… lmethionylaspartylisoleucylthreonyllys… yltryptophylprolyllysylprolyllysylhist… soleucylthreonylglycyltyrosylvalylisol… llysylglycylserylaspartylglutaminyltry… eonylthreonylvalyllysylglycylleucylglu… raginylleucylthreonylglutamylglycylglu… lanylglutaminylvalylmethionylalanylval… ylserylalanylprolylarginylglutamylsery… sylglutamylglutaminylthreonylmethionyl… eucylarginylglycylisoleucyltyrosylglut… yllysylalanylglycylaspartylasparaginyl… lprolylvalylleucylglycylarginylprolyll… tophyllysyllysylglycylaspartylglutamin… eonylglutaminylarginylvalylasparaginyl… lalanylthreonylserylthreonylisoleucyll… lglutamylcysteinylvalylarginylserylasp… leucylthreonylalanylarginylasparaginyl… ycylaspartylvalylisoleucylthreonylisol… lisoleucylprolylglycylprolylprolylthre… lalanylaspartylglutamylvalylserylseryl… enylalanylseryltryptophylaspartylproly… lycylglycylvalylprolylisoleucylserylas… ethionylarginylglutaminylthreonylaspar… alylglutamylleucylalanylthreonylthreon… onyltyrosyllysylalanylthreonylarginyll… utamyltyrosylglutaminylphenylalanylarg… aginylarginyltyrosylglycylvalylglycylp… anyltryptophylisoleucylvalylalanylaspa… ylvalylprolylglycylprolylprolylglycylt… lalanylvalylthreonyllysylaspartylseryl… tophylhistidylglutamylprolylleucylsery… leucylleucylglycyltyrosylhistidylvalyl… asparaginylglycylisoleucylleucyltrypto… ylalanylleucylvalylprolylglycylasparag… serylglycylleucylthreonylaspartylglycy… ylalanylarginylvalylisoleucylalanylglu… yllysylseryllysylprolylseryllysylproly… alanylleucylaspartylprolylisoleucylasp… alylprolylleucylasparaginylisoleucylth… hreonylleucyllysyltryptophylalanyllysy… lglycylphenylalanyllysylisoleucylthreo… yllysylarginylaspartylleucylprolylaspa… llysylalanylasparaginylphenylalanylser… lasparaginylglutamylphenylalanylthreon… tamylaspartylalanylalanyltyrosylglutam… alanyllysylasparaginylalanylalanylglyc… erylglutamylprolylserylaspartylalanyli… artylaspartylvalylglutamylalanylprolyl… yllysylphenylalanyllysylaspartylthreon… ycylglutamylalanylphenylalanylarginyll… ylglycylarginylprolylprolylprolylthreo… lysylaspartylglycyllysylglutamylleucyl… ucylglutamylisoleucyllysylisoleucylala… lasparaginylleucylvalylasparaginyllysy… laspartylserylglycylalanyltyrosylthreo… raginylprolylglycylglycylphenylalanyla… anylasparaginylvalyllysylvalylleucylas… ylglutamylglycylprolylleucylalanylvaly… glutamyllysylcysteinylvalylleucylseryl… eucylaspartylaspartylglycylglycylalany… sylisoleucylvalylglutaminyllysylarginy… alanyltryptophylthreonylasparaginylval… lvalylthreonyllysylleucyllysylvalylthr… paraginylglutamyltyrosylisoleucylpheny… alylasparaginyllysyltyrosylglycylvalyl… erylglutamylprolylvalylleucylalanylval… lylprolylaspartylprolylprolyllysylaspa… hreonylisoleucylthreonyllysylaspartyls… ptophylglycylhistidylprolylaspartylser… isoleucylisoleucylasparaginyltyrosylis… spartyllysylalanylglycylglutaminylargi… lasparaginyllysyllysylthreonylleucylth… ysylvalylserylglycylleucylthreonylglut… utamylphenylalanylarginylisoleucylmeth… lalanylglycylisoleucylserylalanylproly… ylalanyltyrosyllysylalanylcysteinylasp… prolylglycylprolylprolylglycylasparagi… threonylserylarginylserylserylisoleucy… raginyllysylprolylisoleucyltyrosylaspa… cylthreonylglycyltyrosylmethionylvalyl… glutamylglutamylaspartylglutamyltrypto… lprolylprolylalanylglycylleucyllysylal… leucylthreonylglycylleucylthreonylglut… rosyllysylisoleucylarginylisoleucyltyr… glutamylglycylleucylglycylglutamylprol… onylprolyllysylalanylglutamylaspartyla… utamylisoleucylglutamylleucylaspartyla… lvalylthreonylisoleucylarginylalanylcy… ylleucylphenylalanylvalylprolylisoleuc… rolylglutamylvalyllysyltryptophylalany… mylserylleucylaspartyllysylalanylseryl… ryltyrosylthreonylleucylleucylisoleucy… inylarginylphenylalanylaspartylserylgl… onylvalylglutamylasparaginylserylseryl… anylvalylasparaginylvalylarginylvalyll… olylprolylglutaminylaspartylleucyllysy… ylthreonylserylvalylthreonylleucylthre… eucylleucylaspartylglycylglycylserylly… isoleucylvalylglutamyllysylarginylglut… tyrosylserylthreonylvalylalanylthreony… hreonylseryltryptophyllysylvalylaspart… lglycylcysteinylseryltyrosyltyrosylphe… utamylasparaginylglutamyltyrosylglycyl… utamylthreonylalanylglutamylserylvalyl… ylleucylprolylprolylglycyllysylisoleuc… lylthreonylarginylasparaginylserylvaly… lysylprolylglutamylhistidylaspartylgly… lglycyltyrosylisoleucylvalylglutamylme… lserylaspartyllysyltryptophylalanylthr… sylvalylthreonylglutamylalanylthreonyl… cylglutaminylglycylglutamylglutamyltyr… rylalanylglutaminylasparaginylglutamyl… olylarginylglutaminylleucylserylvalylp… tylleucylvalylisoleucylprolylprolylala… nylalanylasparaginylthreonylphenylalan… utamylaspartylleucyllysylvalylaspartyl… cylarginylprolylthreonylprolylalanylva… spartylasparaginylvalylprolylleucyllys… valylasparaginylalanylglutamylserylthr… serylleucylleucylthreonylisoleucyllysy… amylaspartylvalylglycylhistidyltyrosyl… ginylserylalanylglycylglutamylalanylis… ginylvalylisoleucylvalylleucylaspartyl… ylglycylprolylvalyllysylmethionylaspar… tylserylisoleucylthreonylleucylseryltr… sylaspartylglycylglycylserylserylisole… oleucylvalylglutamyllysylarginylaspart… onyltryptophylglutaminylisoleucylvalyl… ylthreonylthreonylisoleucyllysylalanyl… glycylcysteinylglutamyltyrosylglutamin… lalanylglutamylasparaginylarginyltyros… ucylasparaginylserylglutamylprolylthre… lylphenylalanyllysylvalylprolylglycylp… lvalylthreonylleucylserylserylarginyla… lutaminyltryptophylasparaginylglutamyl… lycylserylarginylvalylisoleucylglycylt… lysylglutamylarginylasparaginylserylis… ucylasparaginyllysylthreonylprolylisol… henylalanyllysylthreonylthreonylglycyl… utamyltyrosylglutamylphenylalanylargin… ylisoleucylvalylglycylisoleucylglycyll… mylcysteinyltyrosylvalylalanylarginyla… lprolylglycylarginylprolylglutamylalan… ginylasparaginylserylvalylthreonylleuc… lylthreonyltyrosylaspartylglycylglycyl… rosylisoleucylvalylglutamyllysyllysylg… ginyltryptophylmethionyllysylalanylser… oleucylisoleucylaspartylthreonylhistid… glycylleucylvalylglutamylaspartylhisti… ylarginylvalylisoleucylalanylarginylas… nylalanylserylglutamylprolylserylgluta… ylthreonylalanylarginylaspartylglutamy… oleucylserylmethionylaspartylprolyllys… ucylvalylvalylhistidylalanylglycylglut… rtylalanylaspartylisoleucyltyrosylglyc… lisoleucylglutaminyltryptophylisoleucy… mylleucylserylasparaginylthreonylalany… lserylthreonylaspartylphenylalanylalan… laspartylalanylvalylarginylvalylaspart… eucylleucyllysylalanyllysylasparaginyl… ylvalylthreonylvalylasparaginylvalylly… glycylprolylprolylglutamylglycylprolyl… threonylalanylglutamyllysylcysteinylth… olylprolylleucylglutaminylaspartylglyc… ucylasparaginyltyrosylisoleucylvalylgl… lserylarginylleucylvalyltryptophylthre… inylvalylglutaminylthreonylleucylseryl… cylleucylglutamylglycylasparaginylglut… nylisoleucylmethionylalanylvalylaspara… lutamylprolylleucylglutamylserylglutam… ginylprolylphenylalanylvalylvalylproly… lylglutamylvalylthreonylthreonylvalylt… soleucylvalylvalyltryptophylglutamylar… lglycylserylglutamylisoleucylleucylgly… rginylaspartyllysylglutamylglycylisole… lcysteinylhistidyllysylarginylleucylis… eucylarginylvalylthreonylglycylleucyli… aspartyltyrosylglutamylphenylalanylarg… inylalanylalanylglycylleucylserylgluta… yltyrosylglutaminyllysylalanylcysteiny… lprolylglycylprolylprolylasparaginylas… spartylisoleucylthreonylarginylserylse… tophylseryllysylprolylisoleucyltyrosyl… ylisoleucylglutaminylglycyltyrosylisol… artylvalylasparaginylvalylglycylglutam… nylthreonylprolylprolylthreonylglycyli… araginylisoleucylglutamylvalylglutamyl… dylglutamyltyrosylasparaginylphenylala… soleucylasparaginyllysylalanylglycylva… rtylvalylprolylglycylprolylisoleucylis… ucylglutamylalanylprolylaspartylisoleu… amylleucylarginyllysylisoleucylisoleuc… glycylglycylserylleucylarginylleucylph… glycylarginylprolylthreonylprolylgluta… alylaspartylglycylglutamylisoleucylarg… oleucylaspartylvalylthreonylserylseryl… lleucylaspartylasparaginylvalylasparag… yllysyltyrosylthreonylleucylthreonylle… ycylthreonyllysylserylalanylphenylalan… cylaspartylthreonylprolylserylprolylpr… lthreonylglutamylisoleucylthreonyllysy… reonyltryptophylglutamylprolylprolylle… lysylisoleucyllysylasparaginyltyrosyli… utamylalanylthreonylarginyllysylserylt… lasparaginylcysteinylhistidyllysylaspa… laspartylglutaminylleucylglutaminylglu… osylphenylalanylarginylvalylthreonylal… sylglycylisoleucylglycylleucylprolylal… lprolylisoleucyllysylvalylalanylglutam… glycyllysylisoleucylthreonylvalylaspar… raginylserylvalylserylleucylseryltrypt… tidylaspartylglycylglycylseryllysyliso… leucylvalylglutamylmethionylglutaminyl… yltryptophylserylglutamylcysteinylalan… minylalanylvalylisoleucylthreonylaspar… lglutamylglutamyltyrosylleucylphenylal… araginylglutamyllysylglycylarginylsery… anylvalylprolylisoleucylvalylalanyllys… mylprolylaspartylvalyllysylprolylalany… valylglutaminylvalylglycylglutaminylas… alylprolylisoleucylserylglycylarginylp… reonyltryptophylthreonyllysylaspartylg… nylthreonylthreonylarginylisoleucylasp… eucylaspartylleucylthreonylthreonylleu… nylhistidyllysylaspartylaspartylglycyl… cylthreonylvalylalanylasparaginylvalyl… lanylserylisoleucylglutamylisoleucylva… laspartylprolylprolyllysylglycylprolyl… tylvalylserylalanylglutamylserylisoleu… araginylprolylprolylleucyltyrosylthreo… soleucylthreonylasparaginyltyrosylisol… artylthreonylthreonylthreonylthreonylv… ylalanylthreonylvalylalanylarginylthre… llysylleucyllysylthreonylglycylthreony… nylarginylisoleucylphenylalanylalanylg… cylglutaminylserylphenylalanylalanylle… eucylvalylalanylglutaminyltyrosylproly… olylprolylglycylthreonylprolylphenylal… ryllysylaspartylserylmethionylvalyliso… lutamylprolylvalylasparaginylasparagin… ucylglycyltyrosylhistidylleucylglutamy… inylserylisoleucylleucyltryptophylthre… nylisoleucylisoleucylhistidylaspartylt… lanylglutaminylasparaginylleucylglutam… rosylglutamylphenylalanylarginylvalylt… eucylvalylglycylvalylglycyllysylalanyl… ysteinyltyrosylvalylalanylarginylaspar… lylglycylthreonylprolylglutamylprolyli… sparaginylglutamylisoleucylthreonylleu… lprolylvalyltyrosylaspartylglycylglycy… cyltyrosylisoleucylvalylglutamyllysyla… lycylarginyltryptophylmethionyllysylal… ginylvalylisoleucylglutamylthreonylglu… ylglycylleucylthreonylglutamylaspartyl… nylalanylarginylvalylisoleucylalanylly… nylisoleucylseryllysylprolylserylaspar… ylthreonylalanyllysylaspartylglutamylv… eucylserylmethionylaspartylprolyllysyl… isoleucylvalylvalylasparaginylalanylgl… inylleucylglutamylalanylaspartylvalylh… lthreonylisoleucylglutamyltryptophylle… mylisoleucylglutamylglutamylserylalany… ysylasparaginylthreonylaspartylphenyla… ylvalyllysylaspartylalanylisoleucylarg… utaminyltyrosylisoleucylleucylarginyla… cylseryllysylserylphenylalanylprolylva… aspartylarginylprolylglycylprolylproly… lvalylthreonylglycylvalylthreonylseryl… reonyltryptophylserylprolylprolylleucy… laspartylisoleucylserylhistidyltyrosyl… mylthreonylserylarginylleucylalanyltry… lglutamylvalylvalylthreonylasparaginyl… eucylleucylglutamylglycylasparaginylgl… ylisoleucylmethionylalanylvalylasparag… utamylprolylleucylglutamylserylalanylp… aginylprolylphenylalanylvalylleucylpro… ylglutamylvalylthreonylasparaginylisol… nylthreonylvalylcysteinyltryptophylasp… spartylglycylglycylserylglutamylisoleu… alylglutamyllysylarginylaspartylarginy… hylisoleucyllysylcysteinylasparaginyll… aspartylleucylarginylleucylarginylvaly… ylaspartylhistidylglutamyltyrosylgluta… nylglutamylasparaginylalanylalanylglyc… lylalanylthreonylvalyltyrosyltyrosylly… ylphenylalanyllysylprolylglycylprolylp… dylisoleucylvalylaspartylthreonylthreo… reonylleucylalanyltryptophylglycyllysy… ylglycylserylglutamylisoleucylleucylgl… cylcysteinyllysylalanylaspartylglutamy… ylisoleucylvalylthreonylprolylglutamin… hreonylarginylphenylalanylglutamylisol… ylhistidylglutaminylglutamyltyrosyllys… nylleucylasparaginyllysylvalylglycylle… ylvalylprolylglycylthreonylvalyllysylp… tamylalanylprolylglutamylleucylasparty… rginyllysylglycylisoleucylvalylvalylar… rginylisoleucylhistidylisoleucylprolyl… lmethionylprolylglutamylisoleucylthreo… utamylglycylglutamylphenylalanylthreon… ucylglutamyllysylglycylvalylasparaginy… ylisoleucylaspartylasparaginylcysteiny… alanylglycyllysyltyrosylisoleucylleucy… lserylglycylseryllysylserylalanylpheny… leucylaspartylthreonylprolylglycylprol… alanylvalyllysylglutamylvalylarginylly… eucylvalyltryptophylglutamylprolylprol… lycylalanyllysylvalyllysylasparaginylt… ginylglutamylserylthreonylarginyllysyl… serylseryllysylcysteinylseryllysylthre… amylasparaginylleucylthreonylglutamylg… henylalanylarginylvalylmethionylalanyl… anylglycylvalylglycylvalylprolylvalylg… alyllysylalanylalanylglutamylprolylpro… lthreonylleucylthreonylaspartylvalylse… ylleucylmethionyltryptophylglutamyllys… cylglycylserylarginylvalylleucylglycyl… lutaminylprolyllysylglycylthreonylglut… lylalanylglutamylseryllysylvalylcystei… nylglycylleucylserylserylglycylglutami… lanylarginylvalyllysylalanyltyrosylasp… ylaspartylprolylarginylvalylleucylglyc… sylaspartylleucylthreonylisoleucylglut… rolylphenylalanylasparaginylthreonylty… glycylglutamylaspartylleucyllysylisole… leucylglycylarginylprolylarginylprolyl… valyllysylaspartylglycylglutamylprolyl… ylarginylvalylasparaginylvalylglutamyl… threonylvalylleucylhistidylisoleucylly… partylaspartylphenylalanylglycyllysylt… reonylasparaginylserylalanylglycylthre… ylleucylserylvalylisoleucylvalylleucyl… ylvalylglycylprolylvalylarginylphenyla… ylaspartylphenylalanylvalylvalylisoleu… lylalanyltyrosylthreonylglycylglycylcy… raginyltyrosylisoleucylvalylglutamylly… hreonylthreonylthreonyltryptophylhisti… lvalylalanylarginylthreonylthreonyliso… ucyllysylthreonylglycylthreonylglutamy… ylisoleucylphenylalanylalanylglutamyla… serylalanylprolylleucylaspartylserylly… nyltyrosylprolylphenylalanyllysylgluta… reonylprolylphenylalanylvalylthreonyls… aminylmethionylleucylvalylglutaminyltr… asparaginylaspartylglycylglycylthreony… ylhistidylleucylglutamylglutaminyllysy… ucylleucyltryptophylvalyllysylleucylas… ylglutaminylaspartylthreonyllysylpheny… eucylaspartylglutamylglycylleucylgluta… valylserylalanylglutamylasparaginyliso… ylprolylseryllysylvalylserylglutamylcy… ylaspartylprolylcysteinylaspartylproly… lanylisoleucylvalylisoleucylthreonylar… eonylleucyllysyltryptophyllysyllysylpr… ylseryllysylisoleucylthreonylglycyltyr… laspartylleucylprolylaspartylglycylarg… erylphenylalanylthreonylasparaginylval… nylalanylthreonylvalylserylglycylleucy… inyltyrosylglutamylphenylalanylarginyl… nylalanylalanylglycylasparaginylphenyl… tylserylserylglycylalanylisoleucylthre… oleucylaspartylalanylprolylasparaginyl… ltyrosyllysylaspartylvalylisoleucylval… threonylphenylalanylvalylleucylglutamy… yllysylprolylisoleucylprolylaspartylva… lglycyllysylglutamylleucylglutamylglut… ionylglutamylisoleucyllysylserylthreon… hreonylleucylvalylvalyllysylaspartylcy… rtylglycylglycylglutaminyltyrosylisole… ylvalylglycylglycylthreonyllysylseryli… llysylvalylleucylaspartylarginylprolyl… ylleucyllysylvalylthreonylglycylvalylt… tyrosylleucylalanyltryptophylasparagin… tylglycylglycylalanylasparaginylisoleu… leucylglutamyllysylarginylglutamylthre… ylthreonylglutaminylvalylserylthreonyl… asparaginyltyrosyllysylvalylthreonylly… nylglutamyltyrosylisoleucylphenylalany… paraginyllysyltyrosylglycylisoleucylgl… ylglycylprolylvalylthreonylalanylcyste… olylprolylglycylprolylprolylserylthreo… oleucylthreonyllysylaspartylserylmethi… nylarginylprolylvalylaspartylaspartylg… lglutamylglycyltyrosylisoleucylleucylg… tamylglycylvalylarginyltryptophylthreo… sylthreonylleucylthreonylaspartylleucy… lycylleucylthreonylglutamylglycylhisti… arginylvalylalanylalanylglutamylaspara… lutamylprolylserylglutamylprolylserylv… lcysteinylaspartylalanylleucyltyrosylp… sparaginylprolyllysylvalylthreonylaspa… alylserylleucylalanyltryptophylserylly… ycylglycylalanylprolylvalyllysylglycyl… glutamylalanylalanylalanylaspartylglut… inylthreonylprolylprolylthreonylglycyl… ylphenylalanylthreonylvalylthreonyllys… eonylglutamyltyrosylasparaginylphenyla… lisoleucylasparaginylserylglutamylglyc… reonylleucylprolylglycylserylvalylvaly… leucylglutamylprolylprolylglutamylisol… partylleucylarginyllysylvalylvalylvaly… onylleucylarginylleucylphenylalanylval… ylprolylglutamylprolylglutamylvalyllys… amylglycylisoleucylleucylthreonylaspar… glutamylvalylthreonylserylserylphenyla… oleucylaspartylasparaginylvalylthreony… ycylarginyltyrosylasparaginylleucylthr… aginylserylglycylseryllysylthreonylala… larginylvalylleucylaspartylserylprolyl… ucylthreonylisoleucylarginylglutamylva… onylleucylseryltryptophylglutamylproly… lglycylalanyllysylisoleucylthreonylasp… yllysylarginylglutamylthreonylthreonyl… onylisoleucylthreonylasparaginylaspara… threonylphenylalanylarginylisoleucylgl… utamylglycylcysteinylseryltyrosyltyros… nylserylasparaginylglutamyltyrosylglyc… glutamylthreonylthreonylglutamylprolyl… rolylleucylprolylprolylglycylarginylva… threonylarginylasparaginylthreonylalan… lutamyllysylprolylglutamylserylasparty… eonylglycyltyrosylvalylvalylglutamylme… lserylglutamyllysyltryptophylserylthre… llysylthreonylleucylglutamylalanylthre… nylalanylglycylglutamylglutamyltyrosyl… alanylvalylasparaginylglutamyllysylgly… lglutaminylleucylglycylvalylprolylvaly… eucylglutamylisoleucyllysylprolylseryl… ylhistidylthreonylphenylalanylasparagi… lutaminylleucyllysylisoleucylaspartylv… ginylprolylglutaminylalanylthreonylval… aspartylglycylglutaminylthreonylleucyl… lvalylasparaginylvalylserylserylseryll… lserylisoleucyllysylglutamylalanylsery… reonyltyrosylglutamylleucylcysteinylva… lserylisoleucylthreonylvalylprolylisol… lleucylaspartylarginylprolylglycylprol… lisoleucylaspartylglutamylvalylserylcy… ylisoleucylseryltryptophylasparaginylp… lycylglycylcysteinylglutaminylisoleucy… lylglutamyllysyllysylglutamylthreonylt… hylhistidylisoleucylvalylserylglutamin… erylisoleucyllysylisoleucylvalylarginy… lutamyltyrosylglutaminylphenylalanylar… paraginylarginyltyrosylglycyllysylsery… lalanylvalylvalylalanylglutamyltyrosyl… glycylprolylprolylglycylthreonylprolyl… yllysylserylthreonylmethionylleucylval… prolylvalylasparaginylaspartylglycylgl… ltyrosylhistidylleucylglutamyltyrosyll… cylleucyltryptophylseryllysylalanylasp… ylalanylaspartylthreonylglutaminylvaly… lglutamylglycylleucylmethionyltyrosylg… anylglutamylasparaginylisoleucylalanyl… seryllysylserylcysteinylglutamylprolyl… lylcysteinylaspartylprolylprolylglycyl… ylasparaginylisoleucylthreonylarginyll… ophylseryllysylprolylhistidyltyrosylas… cylthreonylglycyltyrosylisoleucylvalyl… lprolylaspartylglycylarginyltryptophyl… sylthreonylasparaginylisoleucylglutami… nylglutamylvalylthreonylglutamylleucyl… rginyltyrosylglutamylphenylalanylargin… araginylalanylalanylaspartylserylvalyl… ylthreonylglycylprolylisoleucylisoleuc… utamylprolylprolylarginylvalylmethiony… lanylarginylaspartylvalylisoleucylvaly… lleucyllysylisoleucylasparaginylalanyl… lprolylleucylprolylvalylisoleucylseryl… isoleucylglutamylisoleucylglutamylglut… tamylisoleucylisoleucylserylthreonylas… ucylleucylthreonylvalyllysylaspartylcy… tylthreonylglycylglutaminyltyrosylvaly… ylvalylalanylglycylthreonylarginylsery… yllysylvalylleucylaspartyllysylprolylg… leucylglutamylisoleucylasparaginylglyc… cysteinylserylleucylseryltryptophylgly… spartylglycylglycylalanylaspartylisole… rginyllysyllysylarginylglutamylthreony… lthreonylisoleucylcysteinylglutamylgly… lthreonylserylcysteinyllysylvalylthreo… raginylglutamyltyrosylisoleucylphenyla… lasparaginyllysyltyrosylglycylvalylgly… lvalylalanylisoleucyllysylalanylleucyl… alylprolylserylprolylprolylthreonylser… rylvalylthreonyllysylglutamylserylmeth… hylserylarginylprolylglutamylserylaspa… cylserylglycyltyrosylisoleucylisoleucy… lasparaginylserylleucylarginyltryptoph… lysylprolylvalyltyrosylaspartylleucyla… leucylarginylglutamylglycylcysteinylgl… valyltyrosylalanylglutamylasparaginyla… rolylserylglutamylthreonylserylprolyll… aspartylprolylvalylphenylalanylleucylp… lyllysylisoleucylvalylaspartylserylgly… reonylisoleucylalanyltryptophylvalylly… glycylglycylalanylprolylisoleucylthreo… yltyrosyllysyllysylserylaspartylaspart… reonylserylisoleucylglutaminylserylleu… osylthreonylisoleucylserylglycylleucyl… ltyrosylvalylphenylalanylarginylvalyll… glycylalanylserylaspartylprolylserylas… minylisoleucylalanyllysylglutamylargin… cylphenylalanylaspartylisoleucylaspart… lthreonylleucylisoleucylvalyllysylalan… onylmethionylthreonylvalylprolylphenyl… ylprolylasparaginylvalylleucyltryptoph… spartylleucylarginylthreonylarginylala… onylaspartylserylarginylthreonylseryll… aginylalanylasparaginylarginylasparagi… hreonylleucylthreonylisoleucylglutamin… alanylserylleucylthreonylleucylvalylva… prolylglycylprolylprolylthreonylaspara… ylaspartylvalylthreonyllysylglutamylse… aspartylvalylprolylglutamylasparaginyl… yllysylasparaginyltyrosylhistidylisole… nylseryllysyllysylalanyltryptophylvaly… aginylcysteinylasparaginylarginylleucy… raginylleucylglutaminylglutamylglycyla… lanylarginylvalylserylglycylglutamylas… valylglycylisoleucylprolylalanylglutam… ysylisoleucylthreonylglutamyllysylprol… cylglycylvalylthreonylserylisoleucylse… ylthreonyltryptophylleucyllysylprolylg… serylarginylisoleucylvalylhistidyltyro… utamyllysylglycylglutaminyllysylaspara… lanylvalylalanyllysylserylthreonylhist… ucylarginylglutamylasparaginylserylglu… larginylvalylphenylalanylalanylglutamy… eucylserylaspartylprolylarginylglutamy… lisoleucyllysylglutamylglutaminylleucy… cylaspartylmethionyllysylasparaginylph… ylvalyltyrosylvalylarginylalanylglycyl… artylisoleucylprolylisoleucylserylglyc… threonylleucylserylarginylaspartylglyc… nylmethionylarginylphenylalanylasparag… ylalanylglutamylasparaginylleucylthreo… lutamylserylvalylthreonylalanylasparty… isoleucylthreonylalanylalanylasparagin… ysylalanylphenylalanylisoleucylasparag… ylarginylprolylglycylprolylprolylthreo… erylaspartylisoleucylthreonylglutamylg… ltryptophylglutamylprolylprolyllysylty… minylvalylthreonylasparaginyltyrosylis… amylthreonylserylthreonylalanylvalyltr… lanylthreonylvalylalanylarginylthreony… nyllysylleucylthreonylthreonylglycylgl… ylalanylarginylisoleucyllysylalanylglu… glycylisoleucylserylaspartylhistidylis… valylthreonylvalyllysylleucylprolyltyr… lylprolylserylthreonylprolyltryptophyl… ylarginylglutamylserylisoleucylthreony… mylprolylvalylserylasparaginylglycylgl… sylhistidylleucylglutamylmethionyllysy… leucylleucyltryptophylglutaminyllysyla… leucylarginylthreonylthreonylhistidylp… ylisoleucylserylalanylglycylleucylisol… inylvalyltyrosylalanylglutamylasparagi… ylprolylserylhistidylprolylserylglutam… spartylalanylcysteinylglutamylprolylpr… soleucylthreonylaspartylisoleucylseryl… ylseryltryptophylglutaminylglutaminylp… ylglycylseryllysylisoleucylthreonylgly… inylarginylaspartylleucylprolylasparty… ylalanylserylphenylalanylthreonylaspar… glutaminylphenylalanylthreonylisoleucy… lasparaginylserylglutaminyltyrosylglut… lanylalanylarginylasparaginylalanylval… nylprolylserylglutamylvalylvalylglycyl… leucylaspartylseryltyrosylglycylglycyl… rolylleucylglutamyltyrosylthreonylglut… anylglycylthreonylserylvalyllysylleucy… lycyllysylprolylalanylprolylthreonylis… ylaspartylaspartyllysylglutamylleucylg… eucylvalylcysteinylvalylglutamylaspara… alanylserylisoleucylleucylisoleucyllys… ylasparaginylserylglycylcysteinyltyros… sparaginylalanylmethionylalanylserylal… inylvalylglutaminylisoleucylleucylaspa… ycylglycylprolylisoleucylglutamylpheny… anylglutamyllysylisoleucylthreonylleuc… ylalanylaspartylaspartylglycylglycylal… yrosylisoleucylvalylglutamyllysylargin… valyltryptophylserylmethionylvalylsery… amylcysteinylisoleucylisoleucylthreony… eucyllysylglycylasparaginylglutamyltyr… ylarginylalanylvalylasparaginyllysylty… rolylleucylglutamylserylaspartylserylv… ylphenylalanylvalylthreonylprolylglycy… lutamylvalylthreonyllysylisoleucylthre… hreonylvalylvalyltryptophylserylarginy… lglycylserylaspartylisoleucylserylglyc… lysylarginylaspartyllysyllysylserylleu… lvalylleucyllysylglutamylthreonylisole… lutaminyllysylvalylthreonylglycylleucy… partyltyrosylglutaminyltyrosylarginylv… alanylalanylglycylglutaminylglycylprol… rylglutamylphenylalanyltyrosyllysylala… artylprolylprolylglycylprolylprolylala… anylaspartylserylthreonyllysylserylser… tophylseryllysylprolylvalyltyrosylaspa… eonylglycyltyrosylvalylvalylglutamylis… mylglutamylglutamylglutamyltryptophylt… sylglycylglutamylvalylarginylthreonylt… ylasparaginylleucyllysylprolylglycylva… lanylarginylvalylserylalanylvalylaspar… ylglycylglutamylprolylisoleucylglutamy… valylglutaminylalanyllysylaspartylisol… amylisoleucylaspartylleucylaspartylval… alylisoleucylalanyllysylalanylglycylgl… eucylisoleucylprolylphenylalanyllysylg… nylvalylthreonyltryptophylarginyllysyl… cylglycylserylaspartylalanylarginyltyr… ylthreonylaspartylserylserylserylleucy… minylvalylthreonylarginylasparaginylas… leucylleucylthreonylisoleucylglutamyla… prolyllysylserylserylthreonylvalylsery… nylprolylalanylalanylcysteinylglutamin… stidylvalylserylarginylglycylthreonylv… spartylprolylprolylleucylisoleucylaspa… lisoleucylasparaginyltyrosylvalylisole… nylthreonyllysylarginylthreonyltryptop… lcysteinylserylserylthreonylserylpheny… leucylserylglutamyllysylthreonylprolyl… larginylvalylleucylalanylglutamylaspar… cylglycylglutamylprolylcysteinylglutam… yllysylalanylalanylglutamylvalylprolyl… lleucylserylmethionyllysylaspartylsery… leucylleucylseryltryptophylthreonyllys… lglycylglycylserylvalylisoleucylthreon… arginyllysylglycyllysylglycylglutamylg… tidylalanylglycylisoleucylseryllysylth… tamylvalylserylglutaminylleucyllysylgl… tamylphenylalanylarginylvalylphenylala… sylglycylleucylserylaspartylprolylvaly… ucylthreonylvalyllysylglutamylleucylis… mylvalylaspartylleucylserylaspartyliso… alylthreonylvalylarginylisoleucylglycy… ucylglutamylleucylprolyltyrosyllysylgl… eucylseryltryptophylleucyllysylasparty… mylserylglutamylphenylalanylvalylargin… tamylasparaginyllysylisoleucylthreonyl… lalanyllysyllysylglutamylhistidylglycy… leucylleucylaspartylasparaginylalanylv… valylprolylisoleucylthreonylvalylisole… lseryllysylprolyllysylglycylprolylisol… tamylisoleucyllysylalanylaspartylseryl… aspartylvalylprolylglutamylaspartylasp… soleucylthreonylcysteinyltyrosylseryli… lthreonylserylglutaminylthreonylaspara… ysteinylserylserylvalylalanylarginylth… lprolylasparaginylleucylvalyllysylaspa… phenylalanylarginylvalylarginylalanylg… cylvalylserylglutaminylprolylleucylval… alanyllysylhistidylglutaminylphenylala… ylprolylglycyllysylprolylvalylisoleucy… ylaspartylglycylmethionylserylleucylth… lvalyltyrosylaspartylglycylglycylseryl… anylhistidylvalylglutamyllysyllysylglu… ylleucyltryptophylglutaminyllysylvalyl… ucylserylglycylarginylglutamyltyrosyla… ylglutamylglycylleucylaspartyltyrosylg… rosylalanylglutamylasparaginylserylala… laspartylprolylseryllysylphenylalanylt… valylaspartylprolylprolylglycylthreony… rtylvalylthreonylarginylglutamylthreon… ophylasparaginylprolylprolylleucylargi… oleucylvalylglycyltyrosylserylisoleucy… ylasparaginylglutamylarginyltryptophyl… nylalanylthreonylaspartylvalylserylglu… onylvalylthreonylglycylleucylserylprol… mylphenylalanylarginylisoleucylisoleuc… ylglycylthreonylisoleucylserylprolylpr… isoleucylisoleucylmethionylthreonylarg… lprolylprolylisoleucylvalylglutamylphe… lphenylalanylaspartylglycylleucylisole… ylserylleucylarginylisoleucyllysylalan… lprolylvalylprolylarginylvalylthreonyl… glycylvalylglutamylisoleucylglutamylly… onylglutamylisoleucylthreonylasparagin… ylleucylphenylalanylvalylarginylaspart… idylarginylglycylvalyltyrosylthreonylv… lanylserylglycylserylalanyllysylalanyl… ylglutaminylaspartylthreonylprolylglyc… cylarginylphenylalanylthreonylasparagi… ysylmethionylthreonylleucyltryptophylt… asparaginylaspartylglycylcysteinylalan… rosylisoleucylisoleucylglutamyllysylar… ucylalanyltryptophylalanylleucylisoleu… utamylalanylglutaminylseryltyrosylthre… ucylasparaginylglycylasparaginylglutam… nylvalylserylalanylvalylasparaginyllys… nylprolylleucylaspartylserylaspartylpr… ucylglutaminyltyrosylthreonylvalylprol… ylprolylglutamylprolylserylasparaginyl… erylisoleucylthreonylleucylthreonyltry… erylaspartylglycylglycylserylglutamyli… isoleucylleucylglutamylarginylarginylg… yltryptophylvalyllysylvalylisoleucylse… glutamylthreonylarginylphenylalanyllys… glutamylglycylasparaginylglutamyltyros… methionylalanylglutamylasparaginylalan… ylserylglycylisoleucylserylarginylleuc… tamylprolylvalylasparaginylprolylproly… yllysylvalylthreonylaspartylthreonylse… eucylglutamyltryptophylseryllysylproly… cylmethionylglutamylisoleucylisoleucyl… amylmethionylcysteinyllysylthreonylasp… histidyllysylvalylasparaginylalanylglu… nylarginyltyrosylthreonylvalylthreonyl… lglutamylglutamyltyrosyllysylphenylala… asparaginylglycylalanylglycyllysylglyc… ylthreonylglycylthreonylisoleucyllysyl… eonylalanylprolylglutamylleucylasparty… phenylalanyllysylglutaminylthreonylhis… lanylserylisoleucylarginylleucylphenyl… nylglycylarginylprolylthreonylprolylth… ylprolylaspartylserylasparaginylleucyl… leucylhistidylthreonylthreonylaspartyl… lthreonylvalylglutamylasparaginylcyste… partylalanylglycyllysyltyrosylthreonyl… nylasparaginylserylglycylseryllysylser… onylvalyllysylvalylleucylaspartylthreo… olylisoleucylthreonylphenylalanyllysyl… erylalanylthreonylleucylmethionyltrypt… ylaspartylglycylglycylalanylarginyliso… alylglutamyllysylarginylglutamylalanyl… lutaminylvalylisoleucylserylglutamylly… ylisoleucylphenylalanyllysylvalylaspar… lycylvalylprolyltyrosyltyrosylphenylal… araginylglutamyltyrosylglycylvalylglyc… ionylprolylglutamylprolylisoleucylvaly… olylalanylprolylprolylarginylarginylle… nylseryllysylserylserylalanylvalylleuc… aspartylhistidylaspartylglycylglycylse… rosylleucylleucylglutamylmethionylargi… ylleucyltryptophylvalylglutamylalanylg… lleucylthreonylphenylalanylthreonylval… llysylthreonylglutamyltyrosylglutamylp… ysylasparaginylaspartylalanylglycyltyr… mylalanylphenylalanylserylserylvalylis… glutaminylisoleucylglutamylprolylthreo… ylisoleucylthreonylasparaginylglutamin… ysylalanylglycylserylprolylphenylalany… ylisoleucylserylglycylarginylprolylala… yllysylleucylglutamylglutamylmethionyl… spartylarginylvalylserylisoleucylthreo… inylthreonylthreonylleucylthreonylvaly… glycylaspartylserylglycylarginyltyrosy… utamylasparaginylthreonylalanylglycylv… alylthreonylvalylvalylvalylisoleucylgl… hreonylglycylprolylisoleucylglutamylva… ylserylcysteinylvalylleucylseryltrypto… ylglycylglycylglycylthreonylglutamylis… oleucylvalylglutamyllysylarginylglutam… tryptophylglutaminylleucylvalylasparag… onylglutaminylisoleucyllysylvalylthreo… ylmethionylglutamyltyrosylserylphenyla… asparaginylarginylphenylalanylglycylva… rylalanylprolylisoleucylisoleucylalany… valylprolylprolylserylalanylprolylthre… ylhistidylvalylserylalanylasparaginyla… tryptophylglutamylglutamylprolyltyrosy… ysylisoleucylisoleucylglycyltyrosyltry… mylarginylasparaginylthreonylisoleucyl… sparaginyllysylvalylprolylcysteinylleu… syllysylvalylthreonylglycylleucylvalyl… glutaminylphenylalanylarginylthreonylt… alanylglycylvalylseryllysylalanylseryl… leucylmethionylalanylglutaminylasparag… glycylarginylprolylglutamylvalylthreon… threonylvalylserylleucylisoleucyltrypt… aspartylglycylglycylseryllysylvalylval… utamylarginyllysylprolylvalylserylglut… ltryptophylleucyllysylcysteinylasparag… rylaspartylasparaginylphenylalanylphen… leucylserylglutamylglycylaspartylthreo… ylvalylleucylalanyllysylasparaginylala… ysylglycylserylglutamylserylthreonylgl… inylaspartylglutamyltyrosylalanylproly… artylalanylarginylleucylhistidylglycyl… larginylalanylglycylserylaspartylleucy… ylglycylglycyllysylprolylglutamylproly… hreonyllysylglycylaspartyllysylglutamy… myllysylvalylserylleucylglutaminyltyro… threonylalanylvalylisoleucyllysylpheny… laspartylserylglycyllysyltyrosylthreon… ylalanylserylglycylthreonyllysylalanyl… alylleucylaspartylserylprolylglycylpro… ylvalylserylarginylvalylthreonylglutam… eucylalanyltryptophylserylleucylprolyl… cylalanylglutamylisoleucylthreonylhist… ginylarginylglutamylthreonylserylargin… soleucylvalylglutamylglycylglutamylcys… sylvalylvalylthreonylarginylleucylisol… tamyltyrosylisoleucylphenylalanylargin… llysyltyrosylglycylprolylglycylvalylpr… lisoleucylvalylalanylarginylasparaginy… prolylserylprolylprolylglycylisoleucyl… reonylglycyllysylglutamylhistidylisole… ptophylthreonyllysylprolylglutamylsery… tamylisoleucylserylasparaginyltyrosyll… myllysylglutamylserylleucylarginyltryp… yllysylaspartyltyrosylvalylvalyltyrosy… valylthreonylserylleucylmethionylgluta… utaminylphenylalanylarginylvalylthreon… lglycylasparaginylserylglutamylprolyls… phenylalanylisoleucylserylcysteinylarg… nylprolylglycylprolylprolylserylalanyl… onylthreonyllysylhistidylserylisoleucy… llysylprolylmethionyltyrosylaspartylgl… valylglycyltyrosylvalylleucylglutamylm… rtylthreonylaspartylglutaminyltryptoph… ylasparaginylalanylthreonylisoleucylar… nylalanylthreonylvalylprolylaspartylle… ysyltyrosylserylphenylalanylarginylval… lysylglycylmethionylserylglutamyltyros… glutamylisoleucylglutamylprolylvalylgl… ucylprolylaspartylleucylglutamylleucyl… sylthreonylvalylthreonylisoleucylargin… nylleucylmethionylvalylserylvalylseryl… lisoleucylthreonyltryptophylseryllysyl… ucylalanylserylarginylalanylisoleucyli… tamylseryltyrosylserylleucylleucylisol… inylarginyltyrosylaspartylalanylglycyl… ylalanylglutamylasparaginylglutaminyls… onylvalylleucylvalyllysylvalyltyrosyla… steinylprolylserylvalyllysylvalyllysyl… rylvalylthreonylisoleucylthreonyltrypt… lisoleucylaspartylglycylglycylalanylpr… tyrosylisoleucylvalylglutamyllysylargi… inylalanylphenylalanyllysylthreonylval… yllysylthreonylleucyltyrosylarginyliso… lglycylthreonylmethionylhistidyltyrosy… ylglutamylasparaginylisoleucyltyrosylg… ysteinylglutamylthreonylserylaspartyla… alylprolylleucylvalylprolylalanyllysyl… ylthreonyllysylserylthreonylvalylthreo… sylprolylleucyltyrosylaspartylglycylgl… ltyrosylvalylleucylglutamylalanylcyste… ylarginyltryptophylmethionyllysylvalyl… nylvalylleucylglutamylhistidylthreonyl… glutamylglycylglutamylglutaminyltyrosy… arginylalanylglutaminylasparaginylglut… olylarginylglutamylthreonylvalylthreon… laspartylleucylarginylvalylleucylproly… ylthreonylmethionylprolylglutaminyllys… lylalanylglycylarginylprolylvalylgluta… cylalanylglycylarginylprolylprolylprol… alanylphenylalanylalanylglycylseryllys… larginylvalylthreonylvalylglutamylthre… llysylleucylthreonylisoleucylarginylgl… nylaspartylthreonylglycylglutamyltyros… asparaginylvalylthreonylglycylthreonyl… cyllysylvalylisoleucylisoleucylleucyla… lthreonylglycylprolylisoleucyllysyliso… rtylalanylthreonylserylisoleucylthreon… rolylprolylglutamylleucylaspartylglycy… ltyrosylvalylvalylglutamylglutaminylar… rolylglycyltryptophylleucylprolylvalyl… nylserylthreonylphenylalanyllysylpheny… lglutamylglycylasparaginylglutamyltyro… nylalanylthreonylasparaginylarginylphe… tyrosylleucylglutaminylserylglutamylva… lserylserylisoleucylarginylisoleucylpr… nylleucylglutaminylisoleucylphenylalan… glycylmethionylthreonylleucylthreonylt… laspartylaspartylglycylglycylserylglut… leucylvalylglutamylarginyllysylglutamy… ryptophylvalylarginylvalylasparaginyll… ylthreonylarginyltyrosylarginylserylth… lycylleucylglutamyltyrosylglutamylhist… ucylasparaginylalanylarginylglycylsery… lseryllysylprolylisoleucylvalylalanylm… ylprolylprolylglycyllysylprolylglutami… eonylaspartylthreonylthreonylarginylth… yptophylserylvalylprolylglutamylaspart… ylthreonylglycyltyrosylleucylisoleucyl… ylaspartylglutaminylhistidylglutamyltr… aginylthreonylthreonylprolylthreonylly… hreonylleucylthreonylhistidylleucylpro… rosylarginylphenylalanylarginylvalylle… lglycylglycylprolylglycylglutamylproly… eonylvalyllysylvalylthreonylglutamylme… spartyltyrosylglutamylleucylaspartylgl… mylglycylisoleucylphenylalanylvalylarg… eucylarginylleucylthreonylisoleucylpro… henylalanylprolylisoleucylcysteinyllys… ycylglutaminylaspartylisoleucylserylly… lanylthreonylserylglutamylthreonylhist… eucyllysylglutamylalanylaspartylarginy… yrosylaspartylleucylvalylleucylglutamy… yllysylalanylvalyltyrosylisoleucyllysy… rylprolylasparaginylserylprolylglutamy… spartylaspartylisoleucylglutaminylvaly… tryptophylarginylprolylprolylalanylasp… rtylisoleucylleucylglycyltyrosylisoleu… amylvalylprolyllysylalanylalanyltrypto… lserylarginylvalylarginylglycylthreony… ucyllysylglutamylasparaginylvalylgluta… ylvalylserylalanylglutamylasparaginylg… lseryllysylprolylleucyllysylserylgluta… llysylthreonylprolylleucylasparaginylp… lasparaginylprolylprolylglutamylvalyll… lserylvalylserylleucylseryltryptophyls… tylglycylglycylserylarginylvalylthreon… amylarginyllysylglutamylthreonylserylt… ylhistidylasparaginyllysylthreonylglut… onylmethionyltyrosylthreonylvalylthreo… lanylglutamyltyrosylglutaminylphenylal… glutaminylasparaginylaspartylvalylglyc… rolylalanylserylglutamylprolylvalylval… lalanylaspartyllysylprolylserylglutami… ylisoleucylleucylserylisoleucylserylly… glutaminyltryptophylglutamyllysylproly… cyllysylglutamylisoleucylleucylglycylt… larginylglutaminylserylglycylaspartyls… asparaginyllysylglutamylarginylisoleuc… lalanylthreonylisoleucylglycylglycylle… tamyltyrosylglutamylphenylalanylarginy… araginylglutamylthreonylglycylleucylse… nylalanylmethionylserylisoleucyllysylt… ylglutamylalanylprolylglycylisoleucyla… partylvalylthreonylthreonyllysylleucyl… lleucylserylcysteinylglutaminylisoleuc… lylaspartylisoleucyllysyltryptophyltyr… lutamylleucylisoleucylglutaminylseryla… ylserylaspartylglycylarginylthreonylhi… thionylthreonylglutamylglutamylglutami… lyltyrosylthreonylcysteinylisoleucylal… lglycylglutamylvalylglutamylthreonylse… aminylalanylthreonylprolylglutaminylph… ylprolylleucyllysylglutamyllysyltyrosy… lthreonylleucylarginylleucylhistidylva… rginylprolylvalylprolylalanylmethionyl… dylglycylglutaminyllysylleucylleucylgl… araginylisoleucylthreonylisoleucylglut… idyltyrosylthreonylhistidylleucylvalyl… minylarginyllysylthreonylhistidylalany… inylleucylserylasparaginylvalylphenyla… nylisoleucylleucylaspartylvalylglutamy… olylaspartyllysylprolylthreonylglycylp… lalanylleucylleucyllysylasparaginylser… yllysylprolylprolylalanylaspartylaspar… ucylthreonylasparaginyltyrosylvalylval… nyllysylglutamylglycylalanylglutamyltr… erylalanylisoleucylserylvalylthreonylt… ylasparaginylleucylthreonylglutamylasp… henylalanylarginylvalylserylalanylglut… ylglycylisoleucylserylaspartylprolylle… ylisoleucylisoleucyllysylserylprolylph… alanylprolylglycyllysylprolylthreonyli… lysylaspartylserylcysteinylvalylvalyla… nylserylaspartylglycylglycylalanyllysy… tyrosylleucylglutamyllysylarginylgluta… ysyltryptophylisoleucylserylvalylthreo… larginylglutamylthreonylvalylphenylala… isoleucylglutamylglycylleucylglutamylt… lyllysylcysteinylglutamylasparaginylle… yltryptophylserylglutamylisoleucylsery… lyllysylserylaspartylvalylprolylisoleu… enylalanyllysylglutamylglutamylleucyla… alylarginyltyrosylglutaminylserylaspar… einyllysylvalylthreonylglycylhistidylp… tryptophyltyrosylarginylglutaminylglyc… anylaspartylglycylleucyllysyltyrosylar… nylalanyllysylglycylglycyltyrosylhisti… ylalanylserylvalylthreonylaspartylaspa… sylglutaminylvalylarginylalanylthreony… erylvalylserylglycylthreonylalanylsery… olylalanyllysylisoleucylhistidylleucyl… ycylmethionylglycylalanylvalylhistidyl… lylvalylserylisoleucyllysylisoleucylpr… lylaspartylprolylvalylisoleucylthreony… taminylaspartylleucylisoleucylaspartyl… ltyrosylglutaminylvalylisoleucylvalylt… onylserylleucylvalylphenylalanylprolyl… yllysylaspartylalanylglycylphenylalany… sylasparaginylarginylphenylalanylglycy… reonylvalylglutamylleucylaspartylvalyl… olylprolylarginylglycylvalyllysylvalyl… rtylserylvalylasparaginylleucylthreony… anylserylaspartylglycylglycylseryllysy… lisoleucylvalylglutamyllysylcysteinyla… arginyltryptophylleucylarginylvalylgly… hreonylarginyltyrosylthreonylvalylisol… lycyllysylthreonylseryltyrosylglutamin… alanylglutamylasparaginyllysylphenylal… ylglutamylprolylserylglutamylprolylthr… aspartyllysylthreonylarginylalanylmeth… amylglutamylvalylaspartylglutamylthreo… ylthreonyllysylalanylserylhistidylsery… rosylglutamyllysyltyrosylmethionylisol… ycylarginylglycylglutamylphenylalanylg… ysteinylvalylglutamylthreonylserylsery… alanyllysylphenylalanylvalyllysylvalyl… ylvalylleucylvalyllysyllysylglutamylis… nylisoleucylalanylarginylhistidylargin… lleucylhistidylglutamylserylphenylalan… tamylleucylvalylmethionylisoleucylphen… ylserylglycylleucylaspartylisoleucylph… sparaginylthreonylserylalanylphenylala… larginylglutamylisoleucylvalylseryltyr… teinylglutamylalanylleucylglutaminylph… ylasparaginylisoleucylglycylhistidylph… rolylglutamylasparaginylisoleucylisole… larginylserylserylthreonylisoleucyllys… lanylglycylglutaminylalanylarginylglut… ylasparaginylphenylalanylarginylleucyl… lylglutamyltyrosyltyrosylalanylprolylg… dylaspartylvalylvalylserylthreonylalan… ylserylleucylglycylthreonylleucylvalyl… isoleucylasparaginylprolylphenylalanyl… inylglutaminylglutaminylisoleucylisole… hionylasparaginylalanylglutamyltyrosyl… lglutamylalanylphenylalanyllysylglutam… anylmethionylaspartylphenylalanylvalyl… ylglutamylarginyllysylserylarginylmeth… nylleucylglutaminylhistidylprolyltrypt… eucylglutamylarginylvalylserylthreonyl… eucyllysylhistidylarginylarginyltyrosy… ucyllysyllysylaspartylleucylasparaginy… ylarginylisoleucylserylcysteinylglycyl… utaminyllysylglycylvalylserylvalylalan… oleucylglutamylisoleucylglycylprolylva… thionylhistidylalanylvalylglycylglutam… lysyltyrosylvalylcysteinyllysylisoleuc… lglutaminylserylthreonylglutaminylvaly… nylglycylvalylarginylglutaminylleucylg… ltyrosylglutamylisoleucylthreonyltyros… isoleucylleucyltyrosylvalyllysylaspart… tylaspartylglycylthreonyltyrosylarginy… laspartyltyrosylglycylglutamylaspartyl… ylphenylalanylvalyllysylglycylvalylarg… osyltyrosylcysteinylarginylarginylthre… ylarginylarginylthreonylaspartylthreon… mylarginylprolylprolylglutamylphenylal… ylasparaginyllysylthreonylalanyltyrosy… larginylphenylalanylglycylvalylthreony… ylglutamylprolylhistidylvalylthreonylt… taminyllysylisoleucyllysylprolylglycyl… yltyrosylthreonylphenylalanylglutamyls… lglutaminylleucylthreonylisoleucylaspa… partylaspartylaspartylalanylglutamylty… lasparaginyllysyltyrosylglycylglutamyl… sylleucylthreonylvalylthreonylleucylhi… artylserylthreonylleucylarginylprolylm… cylleucylalanylasparaginylalanylglutam… glutaminylserylvalylcysteinylphenylala… ylglycylisoleucylprolylprolylprolylthr… ysylaspartylglycylglutaminylprolylleuc… lisoleucylglutamylisoleucylisoleucylhi… yrosyltyrosylalanylleucylhistidylisole… olylglutamylaspartylthreonylglycyltyro… lthreonylasparaginylthreonylalanylglyc… inylalanylhistidylleucylglutaminylvaly… llysyllysylglutaminylglutamylphenylala… istidylglutamylarginylhistidylvalylglu… rtyllysylthreonylleucylarginylmethiony… glycylthreonylglutamylserylvalylprolyl… lysylglutamylalanylleucylarginylglutam… ylprolylalanylvalylserylthreonyllysylt… ylalanylarginylleucylglutamylisoleucyl… lutamylarginyllysylleucylarginylmethio… glutamylprolylarginyllysyltyrosyllysyl… glutamylglutamylaspartylglutaminylargi… anylvalylprolylmethionylserylaspartylm… lysylisoleucylarginylaspartylglutaminy… yllysylleucylaspartylarginylvalylvalyl… ginylisoleucylarginylleucylserylarginy… alanyltyrosylvalylmethionylprolylleucy… rtylglutaminyltyrosylarginylprolyllysy… sylleucylserylglutaminylaspartylaspart… ylprolylalanylarginylarginylarginylthr… ylaspartylphenylalanyltyrosyltyrosylar… ylleucylglycylaspartylisoleucylserylas… eucylprolylisoleucylaspartylaspartylty… nylthreonylglutamylglutamylglutamylarg… amylglutamylleucylglutamylleucylglycyl… rolylserylarginylserylprolylprolylhist… serylleucylarginyltyrosylserylserylpro… ylvalylglutamylglutamylthreonylarginyl… tyrosylserylthreonyltyrosylhistidyliso… amylalanylserylthreonylseryltyrosylala… inylhistidylalanylglutaminylalanylalan… ylglutaminylarginylglutaminylarginylis… ylglutamylaspartylglutamylglutamylleuc… hreonylthreonylglutaminylhistidylleucy… amylleucylaspartylphenylalanylmethiony… ylarginyllysyllysylserylarginylarginyl… nylglutamylisoleucylthreonylglutamylis… sylglutamylisoleucylseryllysylhistidyl… lserylserylserylalanylserylarginylleuc… lserylleucylserylprolylthreonyltyrosyl… inylprolylvalylserylglutamylleucylisol… minylprolylalanylglutamylglutamyltyros… lutamylarginylarginylserylprolylthreon… nylprolylarginylserylprolylserylprolyl… leucylserylarginylphenylalanylglutamyl… ylaspartylisoleucylphenylalanylserylar… ysylalanylalanylleucyllysylthreonylglu… ginyllysyltyrosylglutamylvalylleucylse… alanylthreonylleucylaspartylhistidylal… eucylarginylmethionylarginylserylhisti… lglutaminylasparaginylthreonylarginylp… ylvalylglutaminylseryllysylprolylthreo… yltyrosylhistidylasparaginylglycylvaly… rylseryllysylisoleucylhistidyltyrosylt… ylvalylleucylthreonylleucylglutamyliso… ylthreonylaspartylaspartylserylglycylt… teinylthreonylasparaginyltyrosyllysylg… osylalanylthreonylleucylaspartylvalylt… hreonylthreonyltyrosylalanylserylgluta… glutamylvalylprolylarginylserylvalylph… nylarginylthreonylglutamylalanyltyrosy… lysyllysylthreonylserylglutamylmethion… larginylglutamylvalyllysylserylglutami… larginylglutamylserylleucylserylserylt… rylalanylglutamylmethionyllysylserylal… ylserylleucylglutamylglutamyllysylsery… cyllysylthreonylthreonylleucylalanylal… ysylprolylarginylserylmethionylthreony… serylalanylarginylphenylalanylserylcys… lglutamylprolylvalylprolylthreonylvaly… ylglycylglutaminylvalylleucylserylthre… minylvalylthreonylthreonylthreonyllysy… nylglutamylisoleucylserylserylvalylglu… lycylasparaginyltyrosylserylvalylvalyl… ylglycyllysylglutaminylglutamylalanylg… reonylisoleucylglutaminyllysylalanylar… ylvalylthreonylserylprolylprolylarginy… larginylvalyllysylserylprolylglutamyla… nylvalyllysylserylprolylglutamylprolyl… serylprolylthreonylglutamylthreonyllys… yllysylvalylglutaminylhistidylleucylpr… ylisoleucylthreonylglutaminylphenylala… eryllysylglutamylisoleucylalanyllysyll… tamylserylserylvalylleucylarginylalany… yltyrosyllysylaspartylglycyllysyllysyl… lhistidylphenylalanylglutaminylphenyla… rtylglycylthreonyltyrosylglutamylleucy… ylleucylthreonylglutamylserylaspartylg… cysteinylglutamylisoleucylserylglycylg… ylthreonylasparaginylleucylglutaminylp… lalanylphenylalanyllysylserylisoleucyl… lisoleucylserylglutamylthreonyllysylly… onylthreonylglutamylserylthreonylvalyl… lprolyllysylalanylprolylglutamylprolyl… isoleucylvalylthreonylglycylleucylglut… serylserylaspartylserylvalylalanyllysy… threonylglycylglutamylprolylarginylpro… lthreonyllysylaspartylglycyllysylalany… lycyllysyltyrosyllysylleucylserylgluta… lanylphenylalanylleucylglutamylisoleuc… onylserylaspartylserylglycylleucyltyro… sylasparaginylserylalanylglycylserylva… cylthreonylisoleucyllysylalanylisoleuc… ylglutaminyllysylvalylserylthreonylglu… oleucylthreonylprolylglutaminyllysylly… ylglutamylisoleucylserylglutaminyllysy… utamylisoleucyllysylmethionylserylglut… myllysylleucylalanylleucyllysylglutamy… lisoleucylserylglutamylglutamylvalylly… rylleucylglutamyllysylserylisoleucylva… lthreonyllysylthreonylserylglutaminyla… nylthreonylhistidylalanylglutamylisole… eonylglutaminylmethionylserylisoleucyl… arginylleucylvalylleucyllysylalanylasp… threonylaspartylvalyllysyltryptophylva… amylleucylthreonylasparaginylserylglut… ycylvalylserylglycylserylaspartylgluta… llysylglutaminylalanylserylhistidylarg… leucylthreonylcysteinylisoleucylseryll… eucylvalyllysylcysteinylglutaminyltyro… llysylglutamylleucylserylaspartylalany… erylglutaminylprolylarginylserylglutam… glutamylglycylglutaminylasparaginylval… ylglutamylisoleucylserylglycylglutamyl… lutamyltryptophylphenylalanyllysylaspa… ucylserylisoleucylserylserylasparaginy… ylarginylasparaginylvalyltyrosylseryll… ginylalanylserylvalylserylaspartylsery… llysylalanyllysylasparaginylphenylalan… erylalanylthreonylalanylserylleucylmet… lutamylglutamylprolylserylarginylgluta… erylglycylaspartylthreonylserylleucylg… ylserylglutaminylserylvalylglutaminylm… inylglutamylalanylserylphenylalanylser… erylalanylserylserylmethionylthreonylg… anylserylmethionylserylalanylglutaminy… lutaminylglutamylserylphenylalanylvaly… rylphenylalanylmethionylglycylisoleucy… lutaminylleucylglutamylserylserylthreo… anylglycylisoleucylarginylglycylisoleu… ylalanylleucylprolylserylaspartylisole… lycyllysylvalylleucylthreonylvalylalan… ylglycylglutamylprolylthreonylprolylgl… ysteinylglycylglycylarginyllysylisoleu… lutaminylglycylarginylphenylalanylhist… eonylaspartylaspartylleucylthreonylthr… nylaspartylvalylglutaminyllysylglutami… lthreonylleucylserylleucylglycylaspara… laspartylserylalanylthreonylvalylaspar… inylserylisoleucine




Full chemical name of titin 

Methionylthreonylthreonylglutaminylala…
ylglutaminylprolylleucylglutaminylsery…
lserylthreonylalanylthreonylphenylalan…
rylglycylphenylalanylprolylvalylprolyl…
lanylarginylaspartylglycylglutaminylva…
nylleucylprolylglycylvalylglutaminylis…
ylglycylarginylalanyllysylleucylthreon…
llysylalanylasparaginylserylglycylargi…
eonylasparaginylglycylserylglycylgluta…
nylglutamylleucylleucylvalyllysylalany…
asparaginylphenylalanylvalylglutaminyl…
ylthreonylvalylarginylglutaminylglycyl…
utaminylvalylarginylvalylthreonylglycy…
lylvalyllysylphenylalanyltyrosylarginy…
cylglutaminylserylserylleucylaspartylp…
glutaminylglutamylglycylaspartylleucyl…
anylglutamylalanyltyrosylprolylglutamy…
serylvalylasparaginylalanylthreonylasp…
ylthreonylserylthreonylalanylglutamyll…
tamylglutamylglutamylvalylprolylalanyl…
eucylvalylserylthreonylalanylglutaminy…
glutaminylthreonylarginylisoleucylglut…
ylhistidylphenylalanylaspartylalanylar…
lylglutamylmethionylvalylisoleucylaspa…
nylglutaminylleucylprolylhistidyllysyl…
lprolylprolyllysylprolyllysylserylargi…
erylisoleucylalanylalanyllysylalanylgl…
ylglutaminylserylprolylserylprolylisol…
lprolylvalylarginylhistidylvalylarginy…
lylvalylarginylserylvalylserylprolylal…
onylserylprolylisoleucylarginylserylva…
thionylarginyllysylthreonylglutaminyla…
ylglycylprolylglutamylvalylprolylproly…
tamylglycyltyrosylvalylalanylserylsery…
ylarginylglutamylthreonylthreonylleucy…
minylisoleucylarginylthreonylglutamylg…
cylarginyltyrosylglycylvalylglutaminyl…
eucylserylglycylalanylalanylglycylalan…
serylalanylseryltyrosylalanylalanylglu…
lalanyllysylglutamylvalyllysylglutamin…
lanylalanylvalylalanylthreonylvalylval…
lalanylarginylvalylarginylglutamylprol…
tamylglutaminylthreonylalanylglutaminy…
eonylalanylvalylhistidylisoleucylgluta…
glutaminylvalylarginyllysylglutamylala…
threonyllysylvalylvalylvalylalanylalan…
lutaminylglutamylleucyllysylserylargin…
leucylthreonylthreonyllysylglutaminylg…
alylthreonylhistidylglutamylglutaminyl…
ylglutamyllysylthreonylphenylalanylval…
ylalanylalanyllysylalanyllysylglutamyl…
oleucylserylglutamylglutamylisoleucylt…
taminylvalylthreonylglutaminylglutamyl…
ylthreonylarginyllysylthreonylvalylval…
nylthreonylprolyllysylvalyllysylglutam…
larginylglycylarginylglutamylglycyliso…
lutamylglutaminylvalylglutaminylisoleu…
ethionylarginyllysylglutamylalanylglut…
hreonylisoleucylalanylvalylalanylthreo…
utaminylglutamylthreonylisoleucylleucy…
onylmethionylalanylthreonylarginylglut…
utaminylvalylthreonylhistidylglycyllys…
lalanylglutamylalanylvalylalanylthreon…
ylglutaminylalanylarginylvalylarginylg…
lycylhistidylleucylglutamylglutamylser…
threonylthreonylleucylglutamyltyrosylg…
leucylserylalanylalanyllysylvalylalany…
nylprolylalanylserylglutamylprolylhist…
llysylprolylarginylvalylisoleucylgluta…
nylhistidylisoleucyllysylthreonylthreo…
hionylhistidylisoleucylserylserylgluta…
eonylaspartylleucylthreonylthreonylglu…
laspartyllysylarginylprolylarginylthre…
alanylthreonylvalylseryllysylisoleucyl…
ylhistidylglycyltyrosylglutamylalanyls…
lisoleucylalanylthreonylleucylglutamin…
eonylserylserylalanylglutaminyllysylis…
alanylprolylthreonylvalyllysylprolylse…
nylalanylglutamylprolylthreonylprolyll…
olylphenylalanylalanylaspartylthreonyl…
erylglutamylalanylglycylvalylglutamylv…
lylserylisoleucylthreonylglycylthreony…
ylarginylphenylalanylglutamylvalylleuc…
yllysylvalylthreonylglutamylthreonylal…
alylglutamylisoleucylprolylvalylthreon…
rylglycylleucyllysylasparaginylvalylth…
lutamylserylvalylthreonylleucylglutamy…
cyltyrosylprolylserylprolylthreonylval…
lutamylaspartyltyrosylglutaminylisoleu…
tylphenylalanylglutaminylisoleucylthre…
ylisoleucylalanylarginylleucylmethiony…
ylalanylalanylglutamylaspartylserylgly…
inylserylalanylvalylasparaginylglutamy…
onylserylcysteinyltyrosylleucylalanylv…
tamylphenylalanylglutamyllysylglutamyl…
glutamyllysylphenylalanylthreonylthreo…
ylalanylvalylglutamylserylarginylaspar…
tylthreonylserylleucylthreonylglutamyl…
lglycylglutamylprolylalanylalanylproly…
yllysylprolylvalylvalylglutaminyllysyl…
lvalylvalylphenylalanylglycylcysteinyl…
nylprolyllysylprolylhistidylvalyltyros…
lylprolylleucylthreonylthreonylglycylt…
tyrosylasparaginyllysylglutaminylthreo…
ylvalylisoleucylserylmethionylthreonyl…
lanylglycylglutamyltyrosylthreonylisol…
sylhistidylglycylglutamylthreonylseryl…
lutamylglutamylalanylaspartyltyrosylgl…
ylglutaminylglutaminylglutamylmethiony…
taminylvalylthreonylalanylphenylalanyl…
ylvalylglycylglutamylthreonylalanylpro…
rylglutamyltyrosylglutamyllysylglutamy…
inylalanylleucylisoleucylarginyllysyll…
eonylvalylvalylvalylarginylthreonyltyr…
glutamylphenylalanylhistidylisoleucyls…
ylarginylleucylisoleucyllysylglutamyli…
ucylisoleucyllysylthreonylthreonylleuc…
mylglutamylaspartylglycylglutamylgluta…
lisoleucylserylglutamylserylglutamylal…
lanylaspartylleucylarginylisoleucyllys…
lleucylglutamylglycylmethionylglycylva…
einyllysylmethionylserylglycyltyrosylp…
yltryptophyltyrosyllysylaspartylglycyl…
lycylglutamylarginyltyrosylglutaminylm…
lutaminylaspartylglycylarginylalanylse…
lvalylleucylprolylglutamylaspartylglut…
lanylphenylalanylalanylserylasparaginy…
nylisoleucylcysteinylserylglycyllysyll…
ylalanylprolylleucylglycylalanylprolyl…
nylleucylglutamylprolylvalylserylargin…
rolylarginylserylvalylserylarginylsery…
ylprolylalanylarginylmethionylserylpro…
lalanylarginylmethionylserylprolylalan…
arginylarginylleucylglutamylglutamylth…
ylleucylglutamylarginylleucyltyrosylly…
yllysylprolylvalylserylphenylalanyllys…
ylasparaginylcysteinylarginylphenylala…
cylarginylprolylmethionylprolylglutamy…
ylalanylhistidylaspartylglycylglutamin…
ylaspartyltyrosylthreonylhistidyllysyl…
artylglycylthreonylglutaminylserylleuc…
ylthreonylprolylserylaspartylserylglyc…
lylalanylglutaminylasparaginylarginyla…
ylserylvalylisoleucylleucylthreonylval…
ylglutaminylvalyllysylprolylmethionylp…
lysylasparaginylvalylasparaginylisoleu…
eucylglutamylmethionyllysylvalylarginy…
lylasparaginylprolylaspartylisoleucylv…
lserylaspartylisoleucylisoleucylvalylp…
lisoleucylarginylisoleucylglutamylglyc…
alanylleucyllysylisoleucylaspartylsery…
ylserylalanyltryptophyltyrosylthreonyl…
ginyllysylalanylglycylarginylaspartylt…
lvalylasparaginylvalylglutamylvalylglu…
ylglutamylprolylglutamylarginyllysylle…
glycylthreonyltyrosylarginylalanyllysy…
lglutamylleucylglutamylprolylleucylhis…
aminylglutamylglutaminyltryptophylglut…
osylaspartyllysylglutamyllysylglutamin…
phenylalanyllysyllysyllysylleucylthreo…
inylphenylalanylglycylprolylalanylhist…
ginylleucylthreonylprolylisoleucylsery…
ylvalylglutamyltryptophylleucylhistidy…
tamylalanylalanylasparaginylarginylleu…
inylglutamylphenylalanylglycyltyrosylc…
lycylvalylalanyltyrosylserylarginylasp…
hreonylcysteinylarginylalanylthreonyla…
laspartylhistidylthreonylserylalanylth…
rtylglutamyllysylserylleucylvalylgluta…
lylglutamylglycylarginyllysylglycylleu…
ylglutamylleucylglutamylarginylmethion…
lleucylthreonylglycylvalylthreonylthre…
lysylglutaminyllysylprolylaspartylisol…
ylprolylvalylarginylvalylleucylglutamy…
lphenylalanylarginylcysteinylarginylva…
minylprolyllysylvalylasparaginyltrypto…
lutaminylleucylisoleucylarginyllysylse…
alylarginyltyrosylaspartylglycylisoleu…
leucylvalylaspartylcysteinyllysylseryl…
ylvalyllysylvalylthreonylalanylglutamy…
ylisoleucylglutamylhistidyllysylvalyll…
ylglutaminylarginylglutamylaspartylphe…
inylarginylalanylprolylglutamylprolyla…
tidylvalylhistidylglutamylprolylglycyl…
utamylvalylglutaminyllysylvalylasparty…
threonylglutamylthreonyllysylglutamylv…
nylglutamylarginylisoleucylthreonylhis…
ylglutamylserylglutamylglutamylleucyla…
ginylarginylthreonylglutamylglutamylgl…
leucylthreonylalanylvalylglutamylleucy…
lglutamylseryltyrosylglutamylglutamyll…
laspartylglutamylleucylleucylhistidylt…
lthreonylglutamylglutamylglutamyllysyl…
amylglycyllysylisoleucylthreonylisoleu…
rolylaspartyllysylisoleucylglutamylleu…
lalanylprolyllysylisoleucylphenylalany…
serylglutaminylthreonylvalylglycylglut…
idylphenylalanylarginylvalylarginylval…
lylglutamylcysteinylglutamyltryptophyl…
ysylisoleucylglutamylarginylserylaspar…
ltyrosyltryptophylprolylglutamylaspart…
leucylvalylisoleucylarginylaspartylval…
ylalanylserylisoleucylmethionylvalylly…
cylalanylglycylglutamylthreonylserylse…
leucylvalylglutaminylalanyllysylglutam…
anylthreonylglutaminylglutamylleucylgl…
ylglutamyllysylaspartylthreonylmethion…
lcysteinylglutamylthreonylserylglutamy…
ysyltryptophyltyrosyllysylaspartylglyc…
tamylglycylaspartyllysyltyrosylarginyl…
yllysylvalylhistidylphenylalanylleucyl…
ylaspartylthreonylserylaspartylalanylg…
lvalylleucylvalylglutamylaspartylgluta…
eonylalanyllysylleucylisoleucylvalylgl…
lphenylalanylvalyllysylglutamylleucylg…
alylprolylglutamylseryltyrosylserylgly…
soleucylvalylserylprolylglutamylaspara…
yptophyltyrosylhistidylasparaginylaspa…
paraginylglycyllysyltyrosylthreonyliso…
ycylarginylglutaminylasparaginylleucyl…
onyllysylglutamylaspartylglutaminylgly…
valylisoleucylaspartylglycyllysyllysyl…
llysylmethionyllysylprolylarginylproly…
aminylglycylleucylserylaspartylglutami…
laspartylisoleucylvalylglutaminylleucy…
glutamylserylvalylglutamylglycylvalylt…
ylglutaminylglutamylvalylglutaminylpro…
lisoleucylvalylisoleucylaspartyllysylg…
ylleucylisoleucylglutamylaspartylmethi…
anylglycylasparaginyltyrosylserylpheny…
lleucylglycylleucylserylthreonylserylg…
erylvalylaspartylvalylisoleucylthreony…
raginylvalylisoleucylglutamylglycylthr…
cysteinyllysylvalylserylvalylprolylasp…
yptophyltyrosylleucylasparaginylaspart…
rolylaspartylaspartylarginylvalylgluta…
lthreonyllysylglutaminylarginylleucylv…
onylhistidylalanylserylaspartylglutamy…
eucylvalylglycylarginylvalylglutamylth…
ylleucylserylvalylglutamyllysylisoleuc…
cylleucylarginylaspartylleucylthreonyl…
utaminylasparaginylvalylvalylphenylala…
histidylserylglycylisoleucylaspartylva…
lalanyllysylaspartyllysylglutamylisole…
yllysylisoleucylglutamylalanylhistidyl…
cylthreonylvalylleucylasparaginylmethi…
lutamylglycyllysyltyrosylthreonylpheny…
sparaginylmethionylthreonylserylglycyl…
lglycylalanylisoleucylseryllysylprolyl…
eonylvalylalanylglutamylserylglutaminy…
tamylcysteinylglutamylvalylalanylaspar…
lglutamyltryptophylleucylarginylaspart…
ucylthreonylasparaginylasparaginylisol…
tylglycylhistidyllysylarginylarginylle…
hreonyllysylleucylaspartylaspartylisol…
yrosyllysylvalylalanylthreonylseryllys…
ylvalylglutamylalanylvalyllysylisoleuc…
raginylleucylthreonylvalylthreonylglut…
lvalylphenylalanylthreonylvalylglutamy…
ginylvalyllysylglycylvalylglutaminyltr…
ycylvalylvalylleucylglutamylserylaspar…
leucylserylvalyllysylglycylthreonyliso…
eucyllysylasparaginylcysteinylalanylis…
lyltyrosylglycylphenylalanylarginylleu…
erylalanylarginylleucylhistidylvalylgl…
oleucyllysyllysylprolyllysylaspartylva…
raginylalanylthreonylvalylalanylphenyl…
istidylaspartylthreonylvalylprolylvaly…
llysylserylvalylglutamylisoleucyllysyl…
inylleucylvalylserylglutamylarginyllys…
leucylglutaminylasparaginylisoleucylse…
lutamyltyrosylthreonylalanylvalylvalyl…
inyllysylalanyllysylleucylphenylalanyl…
isoleucylthreonyllysylthreonylmethiony…
alylprolylglutamylthreonyllysylthreony…
teinylglutamylvalylserylhistidylphenyl…
thionyltryptophylleucyllysylasparaginy…
ylmethionylserylglutamyllysylphenylala…
ylglycyllysylleucylhistidylglutaminyll…
araginylthreonylserylthreonylglutamyla…
reonylphenylalanylvalylcysteinylglycyl…
erylalanylthreonylleucylthreonylvalylt…
eucylthreonylserylmethionylleucyllysyl…
lutamylglutamyllysylaspartylthreonylis…
valylthreonylvalylasparaginyltyrosylgl…
syltryptophylleucyllysylasparaginylgly…
threonylaspartyllysylcysteinylglutamin…
lleucylthreonylhistidylserylleucylaspa…
alylhistidylphenylalanylglycylaspartyl…
phenylalanylvalylalanylglycyllysylalan…
ylleucyltyrosylvalylglutamylalanylargi…
lanylarginyllysylhistidylisoleucyllysy…
lutamyllysyllysylarginylalanylmethiony…
mylvalylserylglutamylprolylaspartyliso…
phylmethionyllysylaspartylaspartylglut…
ucylthreonylaspartylarginylisoleucylly…
lysyltyrosylvalylhistidylarginylleucyl…
rginylmethionylserylaspartylalanylglyc…
nylglycylglycylasparaginylvalylserylth…
valylglutamylglycylarginylaspartylvaly…
cyllysyllysylglutamylvalylglutaminylva…
arginylalanylvalylvalylglutamylphenyla…
ylaspartylaspartylvalylaspartylalanylh…
ylglycylisoleucylglutamylisoleucylaspa…
lutaminylglutamylarginylhistidyllysylt…
nylisoleucylhistidylarginylmethionylph…
eonylarginylglutaminylserylaspartylala…
nylalanylvalylalanylglycylarginylaspar…
lleucyltyrosylvalylasparaginylalanylpr…
alylleucylglutaminylglutamylleucylglut…
minylserylglycyllysylprolylalanylargin…
nylisoleucylserylglycylarginylprolylgl…
yptophyltyrosyllysylglutamylglutamylgl…
ycylphenylalanyllysylcysteinyllysylphe…
ylglutaminylglutamyltyrosylthreonylleu…
nylphenylalanylprolylglutamylaspartyla…
einylglutamylalanyllysylasparaginylasp…
ylthreonylserylalanylserylleucylserylv…
lvalylserylprolylaspartylglutaminylglu…
lylprolylalanylisoleucylisoleucylthreo…
reonylvalylthreonylserylglutamylglycyl…
alanylglutaminylcysteinylarginylvalyls…
ylvalylseryltryptophyltyrosylseryllysy…
olylserylarginylphenylalanylphenylalan…
lphenylalanylglutamylaspartylthreonylt…
ucylalanylglutamylalanyltyrosylprolylg…
yltyrosylthreonylphenylalanylvalylalan…
glycylglutaminylvalylserylserylthreony…
glutamylalanylprolylglutamylserylisole…
oleucylglutamylglutaminylglutamylisole…
nyllysylglutamylphenylalanylserylseryl…
lutamylglutamylglutamylglycylleucylhis…
minylleucylseryllysylisoleucylasparagi…
ucylleucylserylglutamylserylprolylvaly…
anylaspartylserylglutamyllysylglutamyl…
phenylalanylisoleucyllysylglutamylvaly…
eucylserylmethionylglycylaspartylvalyl…
nylvalylisoleucylglycylisoleucylprolyl…
tryptophylphenylalanylphenylalanylaspa…
nylprolylserylalanylaspartyltyrosyllys…
rtylglycylaspartylaspartylhistidylsery…
ylalanylthreonyllysylleucylglutamylasp…
hreonylcysteinylmethionylalanylserylas…
threonylisoleucylcysteinylserylalanylt…
ylseryllysylglycylglutamylglycylhistid…
onylglutamylserylalanylvalylalanyllysy…
ylglycylprolylcysteinylprolylprolylhis…
lleucyllysylprolylisoleucylarginylcyst…
olylalanylisoleucylphenylalanylglutamy…
tamylprolylalanylprolylthreonylvalylth…
utamylasparaginyllysylglutaminylleucyl…
yrosylthreonylisoleucylisoleucylhistid…
lserylglycylthreonylphenylalanylisoleu…
utaminylarginylglutamylaspartylserylgl…
lysylalanylglutamylasparaginylmethiony…
ysteinylalanylalanylglutamylleucylleuc…
threonylaspartylmethionylthreonylaspar…
yllysylserylthreonylprolylglutamylalan…
lprolylglutaminylthreonylprolylleucyll…
alanylleucylaspartylserylglutamylgluta…
lphenylalanylvalyllysylaspartylthreony…
ucylisoleucylthreonylglutamylglutamyla…
lseryltyrosylglutamylhistidylisoleucyl…
lleucylserylserylglutaminylleucylproly…
ylleucylglutaminylserylisoleucylleucyl…
ylthreonylprolylglutamylserylthreonyla…
teinylisoleucylasparaginylglycylseryli…
nylprolylleucyllysylglutamylprolylsery…
eucylglutaminylisoleucylvalylglutaminy…
alanylseryllysylglutamylglycylisoleucy…
mylprolylglutamylthreonylglutaminylala…
glutamyllysylisoleucylphenylalanylprol…
lglutamylglutaminylisoleucylasparaginy…
olylleucyllysylthreonylleucylleucylala…
raginyltyrosylprolylglutaminylserylser…
ionylhistidylseryltyrosylleucylthreony…
lylleucylserylleucyllysylglutamyllysyl…
sparaginylarginylglutamylglutaminylarg…
sylglutaminylglutamylalanylglutaminyls…
lglutaminylserylleucylalanylglutamylgl…
lglutaminylserylprolylaspartylvalylmet…
asparaginyltyrosylglutamylprolylleucyl…
ylcysteinylthreonylglutamylglycylglycy…
mylserylalanylasparaginylprolylleucylg…
minylaspartylserylalanylvalylarginylis…
erylleucylarginylphenylalanylprolylleu…
lglutaminylvalylleucylleucyllysylgluta…
araginylvalylvalylmethionylprolylproly…
ylglutamylseryllysylarginylglutamylpro…
lylglutaminylglutamylvalylglutaminylgl…
llysylglutamylserylleucylleucylserylgl…
glutaminylarginylleucylasparaginylleuc…
cysteinylarginylalanylleucylglutaminyl…
lglutaminylprolylglycylleucylphenylala…
inylasparaginylisoleucylglutamyllysylv…
lasparaginylisoleucylthreonylglutaminy…
ucylmethionylcysteinylmethionyltyrosyl…
serylvalylthreonylglutamylglutamylvaly…
lglutamylaspartylvalylaspartylprolylgl…
eucyllysylmethionylglutamylleucylargin…
ylisoleucylisoleucyltyrosylglutamylglu…
ylthreonylalanylglutamylglycylprolylar…
lycylalanyllysylthreonylserylleucylglu…
artylserylphenylalanylserylglycylseryl…
soleucylthreonylglutamylprolylglutamyl…
lisoleucylserylthreonylglutamylglutamy…
aginylvalylglutaminylserylarginylvalyl…
eonylprolylvalylthreonyllysylglycylval…
spartylglutamyllysylglutaminylaspartyl…
glutamylglutamyllysylglutamylglutamyls…
reonylglutamylglutamylvalylalanylthreo…
tamylalanylglutamylglycylglycylleucyli…
prolylmethionylisoleucylhistidylthreon…
valylserylglutamylglutamylglycylaspart…
nylthreonylserylisoleucylthreonylaspar…
aginyltryptophyltyrosylphenylalanylglu…
lylserylaspartylglutamyllysylphenylala…
partylglutaminylasparaginylthreonyltyr…
artyllysylvalylasparaginylthreonylglut…
lglutamyltyrosylvalylcysteinylglutamyl…
lglycyllysylthreonylalanylthreonylsery…
llysylarginylalanylalanylprolylvalylis…
utamylprolylleucylglutamylvalylalanyll…
lphenylalanylthreonylcysteinylglutamyl…
lasparaginylvalylarginylphenylalanylgl…
alanylglycylarginylglutamylisoleucylty…
einylserylisoleucylarginylserylserylly…
glutamylisoleucylleucylarginylthreonyl…
ylglycylglutamyltyrosylthreonylcystein…
yltyrosylglycylserylvalylserylcysteiny…
ylvalylthreonylvalylprolylglycylglycyl…
leucylleucylprolylglutamylarginyllysyl…
utamylvalylvalylleucyllysylserylvalyll…
mylglutamylglutamylglutamylprolyllysyl…
glutamyllysylvalyllysyllysylprolylalan…
olylprolyllysylprolylvalylglutamylglut…
lvalylthreonyllysylarginylglutamylargi…
ylthreonyllysylvalylprolylglutamylisol…
ylleucylprolylalanylprolylglutamylprol…
nylglutamylvalyllysylthreonylisoleucyl…
lprolylglutamylprolylthreonylprolyliso…
ylvalylprolylvalylvalylglycyllysyllysy…
lyllysylglutamylglutamylalanylalanylly…
lysylglycylvalylprolyllysyllysylthreon…
lalanylglutamylarginylarginyllysylleuc…
cylglutamyllysylprolylprolylaspartylgl…
nyltyrosylglutaminylleucyllysylalanylv…
lyllysylglutamylisoleucyllysylaspartyl…
tamylserylglutamylphenylalanylvalylgly…
lanylglutamylcysteinylleucylvalylseryl…
hreonylthreonyltryptophylmethionyllysy…
eucylarginylglutamylserylprolyllysylhi…
lanylaspartylglycyllysylaspartylarginy…
cylaspartylvalylglutaminylleucylseryla…
hreonylcysteinylvalylleucylarginylleuc…
ylthreonylserylthreonylalanyllysylleuc…
rolylvalylarginylphenylalanylvalyllysy…
amylvalylthreonylvalylvalyllysylglycyl…
serylcysteinylglutamylleucylasparaginy…
alyltryptophylarginyllysylaspartylglyc…
ysylprolylglycylarginylisoleucylvalylp…
ylmethionylarginylalanylleucylthreonyl…
spartylaspartylthreonylaspartylalanylg…
reonylvalylglutamylasparaginylalanylas…
ysteinylserylserylcysteinylvalyllysylv…
nylaspartyltryptophylleucylvalyllysylp…
inylhistidylvalyllysylprolyllysylglycy…
lalanylcysteinylaspartylisoleucylalany…
inylisoleucyllysyltryptophylphenylalan…
lisoleucylprolylalanylglutamylprolylas…
mylisoleucylleucylarginylaspartylglycy…
ucyllysylisoleucyllysylasparaginylalan…
oleucylalanylglutamyltyrosylalanylvaly…
ylarginyltyrosylprolylalanyllysylleucy…
lglutamylvalylglutamylleucylleucyllysy…
ylthreonylisoleucyltyrosylglutamyllysy…
ylaspartylalanylglutamylisoleucylseryl…
ylglycylglutaminyltryptophyllysylleucy…
inylprolylserylprolylthreonylcysteinyl…
lglycylglycyllysylarginylphenylalanyll…
yllysylleucylaspartylglutaminylalanylg…
aminylalanylleucylasparaginylalanyliso…
ylleucylthreonylvalyllysylglutamylisol…
anylalanylvalylprolylleucyllysylaspart…
rginylarginylglutaminylalanylarginylph…
cylthreonylarginylglutamylalanylaspara…
ysylglycylprolylaspartylisoleucylisole…
nylalanylaspartylisoleucylisoleucylala…
isoleucylleucylvalylisoleucylasparagin…
ylaspartylaspartylglutamylglycylvalylt…
utamylglycyllysyllysylthreonylserylala…
reonylglycylisoleucylarginylleucyllysy…
ucylglutamylaspartylglutaminylthreonyl…
eonylalanylthreonylphenylalanylvalylcy…
lutamyllysylmethionylhistidylvalylvaly…
inylaspartylalanyllysylleucylhistidylt…
cylisoleucylserylserylglutamylglycylly…
mylmethionyllysylglutamylvalylthreonyl…
lglutaminylisoleucyllysylalanylglutami…
ylthreonylalanylglutaminylleucyllysylv…
lyltyrosylphenylalanylthreonylvalyllys…
ylalanylvalylglutamyllysylaspartylglut…
teinylglutamylvalylseryllysylaspartylv…
lalanyllysylaspartylglycylglutamylglut…
lysyltyrosylserylisoleucyllysylalanyla…
oleucylleucyllysylisoleucyllysyllysyla…
ylglycylglutamyltyrosylvalylcysteinyla…
tyllysylthreonyllysylalanylasparaginyl…
inylleucylisoleucylglutamylvalylglutam…
ylglutamylvalylphenylalanylvalylglycyl…
lalanylglutamylisoleucylglutamylleucyl…
tidylglycylglutaminyltryptophyllysylle…
ylthreonylalanylserylprolylaspartylcys…
tamylaspartylglycyllysyllysylhistidyli…
ylasparaginylcysteinylglutaminylleucyl…
ylvalylserylphenylalanylglutaminylalan…
alanylalanylasparaginylleucyllysylvaly…
leucylphenylalanylisoleucylthreonylpro…
ylphenylalanylglutamyllysylaspartylglu…
lcysteinylglutamylvalylserylarginylglu…
larginyltryptophylleucyllysylglycylthr…
eonylglycylaspartylaspartylarginylphen…
laspartylglycylthreonyllysylhistidylse…
lalanylalanylphenylalanylglutamylaspar…
nylphenylalanylglutamylalanylglutamyla…
ycyllysylleucylisoleucylisoleucylgluta…
lphenylalanylleucylthreonylprolylleucy…
sylglutamyllysylglutamylserylalanylval…
leucylserylhistidylaspartylasparaginyl…
lphenylalanyllysylasparaginylaspartylg…
nylthreonylarginylserylvalylserylmethi…
llysylthreonylhistidylserylisoleucylth…
ylserylisoleucylaspartylaspartylthreon…
lylglutamylalanylmethionylglycylmethio…
cylthreonylvalylleucylglutamylglycylas…
onylglycyllysylleucylglutaminylasparty…
lysylaspartylglutamylvalylisoleucylleu…
ucylseryllysylalanylaspartylalanylprol…
ysylaspartylglycyllysylglutamylisoleuc…
lanylvalylisoleucyllysylthreonylaspart…
eucylisoleucylleucyllysyllysylalanylle…
ylglutaminyltyrosylthreonylcysteinylas…
yllysylthreonylserylglycyllysylleucyla…
inylglutamylisoleucyllysylleucylvalyla…
lglutamylvalylmethionylglutamylthreony…
lalanylglutamylthreonylglutamylisoleuc…
eucylhistidylalanylasparaginyltryptoph…
nylleucylleucylglutaminylthreonylproly…
lysylglutamylglutamylglycyllysylisoleu…
stidylasparaginylcysteinylarginylleucy…
ycylvalylaspartylphenylalanylglutaminy…
erylserylalanylhistidylleucylarginylva…
glycylleucylleucylarginylprolylleucyll…
nylalanylglycylglutamylthreonylalanylt…
lglutamylleucylseryltyrosylglutamylasp…
yptophyltyrosylleucyllysylglycyllysyll…
yllysylvalylvalylprolylarginylserylglu…
ylleucylthreonylleucylarginylaspartylv…
ylglycylglutamylvalylglutaminylleucylt…
nyllysylthreonylhistidylalanylasparagi…
amylprolylprolylvalylglutamylphenylala…
laspartylglutaminylthreonylvalylglutam…
lvalylleucylglutamylcysteinylglutamylv…
alanyllysylvalyllysyltryptophylphenyla…
glutamylisoleucylleucyllysylseryllysyl…
lanylaspartylglycylarginylvalylarginyl…
partylcysteinylthreonylprolylglutamyla…
lthreonylcysteinylaspartylalanyllysyla…
ylcysteinylasparaginylleucylasparaginy…
lglutamylphenylalanylleucylarginylprol…
minylvalylarginylglutamyllysylglutamyl…
lutamylcysteinylglutamylleucylserylarg…
alyllysyltryptophylphenylalanyllysylas…
lysyllysylglycyllysyllysyltyrosylaspar…
ylalanylvalylarginylisoleucylleucylval…
lleucylleucylaspartylaspartylglutamyla…
lutamylvalylarginylthreonylalanylargin…
lthreonylvalylleucylglutamylglutamylgl…
yllysylasparaginylleucylalanylasparagi…
mylthreonylaspartylthreonylisoleucylly…
lseryllysylprolylglycylalanylglutamylv…
glycylaspartylglutamylglutamylisoleucy…
inyltyrosylglutamylisoleucylleucylthre…
ylisoleucylleucylvalylisoleucylglutami…
lutamylaspartylalanylglycylasparaginyl…
eucylprolylserylserylarginylthreonylas…
tidylglutamylleucylalanylalanylglutamy…
lylglutaminylasparaginylleucylglutamyl…
yllysylalanylglutamylphenylalanylvalyl…
utamylserylphenylalanylprolylvalylglut…
laspartyllysylthreonylleucylglutamylse…
ylvalylisoleucylalanylaspartylglycylly…
llysylaspartylalanylthreonylleucylglut…
yltyrosylvalylvalylmethionylvalylglycy…
nylhistidylleucylthreonylvalylisoleucy…
lvalylvalylprolylleucyllysylaspartylth…
aminylglutaminylglutamylvalylvalylphen…
lvalylasparaginylthreonylglutamylglycy…
enylalanylarginylasparaginylglutamylgl…
partylserylseryllysyltyrosylisoleucyli…
ylleucylvalyltyrosylthreonylleucylargi…
stidylleucylaspartylaspartylglutaminyl…
valylserylleucylthreonylasparaginylhis…
ylvalyllysylserylalanylalanylasparagin…
mylglutamylaspartylleucylarginylisoleu…
partylisoleucylglutamylthreonylmethion…
nylphenylalanyltryptophylcysteinyllysy…
aginylvalylthreonylleucyllysyltryptoph…
tamylglutamylvalylprolylphenylalanylas…
yrosylarginylvalylaspartyllysyltyrosyl…
lisoleucyllysylaspartylcysteinylglycyl…
lycylglutamyltyrosylisoleucylvalylthre…
ysylserylvalylalanylglutamylleucylleuc…
rolylthreonylglutamylphenylalanylvalyl…
tylglutaminylthreonylvalylthreonylglut…
nylvalylphenylalanylserylcysteinylglut…
ylalanylasparaginylvalyllysyltryptophy…
inylglutamylisoleucyllysylglutamylglyc…
lglutamyllysylaspartylglycylserylisole…
soleucyllysylaspartylcysteinylarginyll…
nylglutamyltyrosylalanylcysteinylglycy…
erylarginylalanylarginylleucylphenylal…
rolylvalylglutamylisoleucylisoleucylar…
isoleucylleucylglutamylalanylprolylgly…
anylleucylalanylglutamylleucylasparagi…
alylglutaminyltryptophylleucylarginyla…
valylvalylglutaminylglycylaspartyllysy…
ylserylglutamylglycyllysylisoleucylhis…
ylcysteinylaspartylisoleucyllysylproly…
tamyltyrosylarginylphenylalanylisoleuc…
lanylarginylalanyllysylleucylglutamyll…
soleucyllysylthreonylalanylaspartylglu…
rtylvalylglycyllysylprolylleucylthreon…
spartylalanyltyrosylprolyllysylalanylg…
ylalanyllysylglutamylasparaginylglutam…
eonylisoleucylaspartylthreonylthreonyl…
ylphenylalanylarginylisoleucylleucylgl…
llysylglycylarginyltyrosyllysylisoleuc…
ysylhistidylglycyllysylalanylglutamylg…
ylleucyllysylvalylisoleucylaspartylval…
araginylleucylglutamylvalylthreonylglu…
ycylglutamylvalylserylleucylalanyltryp…
hreonylaspartylglycylglycylseryllysyli…
valylglutamylarginylarginylaspartyliso…
tophylvalylleucylalanylthreonylasparty…
lglutamylphenylalanylthreonylvalylthre…
ylglycylvalylglutamyltyrosylleucylphen…
nylasparaginylarginylvalylglycylthreon…
threonylaspartylasparaginylprolylvalyl…
sylaspartylvalylprolylglycylprolylprol…
leucylthreonylaspartylvalylasparaginyl…
leucylthreonyltryptophylglutamylprolyl…
glycylalanylglutamylisoleucylthreonyla…
amylleucylarginylaspartyllysylthreonyl…
rtylthreonylalanylmethionylthreonylval…
ylserylalanylthreonylvalylthreonylaspa…
nylglutamyltyrosylserylphenylalanylarg…
araginylarginylisoleucylglycylvalylgly…
onylprolylphenylalanylvalyllysylvalyla…
larginylprolylserylprolylprolylvalylas…
partylglutaminylthreonylglutaminylsery…
ptophylglutamylprolylprolylleucyllysyl…
eucylleucylglycyltyrosylisoleucylisole…
lglutamylglycyllysylaspartylasparaginy…
lasparaginylmethionyllysylleucylvalylp…
ysylvalylthreonylglycylleucylglutamyll…
ucyltyrosylarginylvalylserylalanylglut…
ylserylaspartylprolylserylglutamylisol…
ylalanylaspartylaspartylalanylphenylal…
ionylaspartylleucylserylalanylphenylal…
ylvalylisoleucylvalylprolylasparaginyl…
cylvalylprolylserylthreonylglycyltyros…
threonyltryptophylcysteinylphenylalany…
amylthreonylglycylaspartylarginylvalyl…
rylalanyltyrosylalanylglutamylleucylva…
larginylserylaspartyllysylglycylisoleu…
glutamylasparaginylarginylvalyllysylth…
soleucylaspartylvalylasparaginylvalyli…
nylprolyllysylglutamylleucyllysylpheny…
nyllysylaspartylserylvalylhistidylleuc…
rolylaspartylaspartylaspartylglycylgly…
yrosylvalylvalylglutamyllysylarginylgl…
ltryptophylthreonyllysylvalylmethionyl…
partylleucylglutamylphenylalanylthreon…
taminylglycyllysylglutamyltyrosylleucy…
nylarginylasparaginyllysylcysteinylgly…
tyrosylvalylaspartylglutamylprolylvaly…
rolylalanylthreonylvalylprolylaspartyl…
llysyltryptophylarginylaspartylarginyl…
ucylphenylalanylleucylthreonyltryptoph…
nylaspartylglycylglycylserylarginyliso…
lylglutamylarginylcysteinylprolylargin…
lvalylalanylcysteinylglycylglutamylpro…
methionylglutamylvalylthreonylglycylle…
tophyltyrosylalanyltyrosylarginylvalyl…
ylglutaminylglycylalanylseryllysylprol…
lglutamylisoleucylglutaminylalanylvaly…
alanylprolylglutamylisoleucylphenylala…
ucylalanylglycylleucylthreonylvalyllys…
lglutamylleucylprolylalanylthreonylval…
prolyllysylisoleucylthreonyltryptophyl…
lisoleucylleucyllysylglutaminylasparty…
ucylglutamylasparaginylvalylprolyllysy…
leucylvalylaspartylseryllysylarginylse…
rosylisoleucylisoleucylglutamylalanylv…
arginylalanylthreonylalanylvalylvalylg…
spartyllysylprolylglycylprolylprolylal…
ucylthreonylaspartylvalylthreonylaspar…
eucylthreonyltryptophylasparaginylprol…
ylglycylseryllysylisoleucylthreonylasp…
ginylarginylalanylthreonylaspartylsery…
ylleucylserylserylthreonylvalyllysylas…
yllysylalanylthreonyllysylleucylisoleu…
rosylisoleucylphenylalanylarginylvalyl…
ionyltyrosylglycylalanylglycylglutamyl…
lylisoleucylthreonylalanyllysyltyrosyl…
lprolylglycylprolylprolylthreonylargin…
isoleucylthreonyllysylaspartylalanylva…
cysteinylglutamylprolylaspartylasparty…
leucylthreonylglycyltyrosyltryptophylv…
olylaspartylthreonylaspartyllysyltrypt…
yllysylmethionylprolylvalyllysylaspart…
yllysylglycylleucylthreonylasparaginyl…
alanylarginylvalylleucylalanylglutamyl…
glycyllysylprolylseryllysylserylthreon…
eucyllysylaspartylprolylisoleucylaspar…
ylglycyllysylprolylthreonylvalyllysyla…
lvalylarginylleucylasparaginyltryptoph…
ylaspartylglycylglycylalanyllysylisole…
cylglutamylmethionylleucyllysylthreony…
tophylvalylarginylvalylalanylglutamylg…
taminylhistidylleucylleucylprolylglycy…
minylglutamyltyrosylserylphenylalanyla…
ginyllysylalanylglycylglutamylserylglu…
aspartylprolylvalylleucylcysteinylargi…
prolylserylprolylprolylarginyltryptoph…
aginylisoleucylthreonyllysylasparaginy…
ryptophylthreonylvalylprolylglutamylly…
soleucylthreonylasparaginyltyrosylisol…
tylvalylarginylarginyllysylglycyltrypt…
lthreonylthreonylvalyllysylaspartylthr…
eonylprolylleucylthreonylglutamylglycy…
larginylvalylalanylalanylglutamylaspar…
ylserylaspartyltyrosylthreonylglutamyl…
leucylalanyllysylaspartylthreonylpheny…
prolylprolyltyrosylalanylleucylalanylv…
arginylhistidylvalylaspartylleucyllysy…
lasparaginylaspartylglycylglycylarginy…
rosylvalylisoleucylglutamyllysyllysylg…
rginyltryptophylvalyllysylalanylglycyl…
rtylcysteinylasparaginylphenylalanylar…
eucylglutamylglycylthreonylglutamylval…
alylarginylalanylglutamylasparaginylgl…
ylprolylserylglutamylprolylthreonylglu…
lutamylaspartylprolylthreonylserylprol…
rtylleucylhistidylvalylthreonylasparty…
oleucylalanylisoleucylalanyltryptophyl…
aginylglycylglycylserylprolylisoleucyl…
glutamylmethionylcysteinylprolylvalylg…
lmethionylarginylvalylasparaginylseryl…
leucyllysylphenylalanyllysylvalylgluta…
partyllysylglutamyltyrosylvalylleucyla…
ginylalanylisoleucylglycylvalylserylgl…
erylglutamylasparaginylvalylvalylalany…
yllysylprolylthreonylisoleucylaspartyl…
tylisoleucylisoleucylvalylisoleucylglu…
isoleucylprolylvalylprolylphenylalanyl…
threonylvalylseryltryptophylhistidylly…
lysylalanylserylaspartylarginylleucylt…
artylhistidylisoleucylserylalanylhisti…
rylvalylarginylalanylaspartylalanylgly…
lthreonylleucylglutamylasparaginyllysy…
nylserylisoleucylasparaginylvalyllysyl…
cylprolylcysteinyllysylaspartylisoleuc…
threonyllysylserylserylcysteinyllysyll…
ylprolylglutamylphenylalanylaspartylgl…
ucylhistidyltyrosylvalylleucylglutamyl…
rginylarginylthreonyltyrosylisoleucylp…
mylasparaginyllysylleucylseryltryptoph…
soleucylprolylasparaginylglycylglutamy…
inylvalyllysylalanylvalylasparaginylly…
yrosylisoleucylglutamylleucyllysylaspa…
utaminylaspartylprolyllysylglutaminylp…
laspartylvalylglutamylvalylhistidylasp…
lalanylmethionylthreonylisoleucylthreo…
ltyrosylaspartylglycylglycylseryllysyl…
eucylisoleucylglutamyllysylisoleucylal…
nyltryptophyllysylarginylcysteinylaspa…
rolylisoleucylleucylthreonyltyrosylthr…
lglutamylglycyllysylglutamyltyrosylglu…
nylalanylglutamylasparaginylalanylalan…
lserylarginylalanylthreonylprolylproly…
olylisoleucylaspartylalanylprolyllysyl…
serylleucylglutamylvalyllysylarginylgl…
leucylaspartylalanylserylisoleucylsery…
onylisoleucylthreonyltryptophylisoleuc…
alylisoleucylvalylprolylglutamylglutam…
lanylprolylleucylvalylarginylarginylar…
inylglutamylglutamylglutamylprolylphen…
onylglutaminylarginylleucylserylisoleu…
ylglycylglutamylserylglutaminylleucyla…
ylarginylprolylaspartylhistidylglycyll…
valylglutamylasparaginylaspartylhistid…
rolylcysteinylthreonylvalylserylvalyll…
olylprolylisoleucylasparaginylphenylal…
ylisoleucylarginyllysylthreonylserylva…
utamylprolylprolylleucylaspartylaspart…
lisoleucylasparaginyltyrosylthreonylle…
threonyllysylprolylaspartylserylglutam…
onylserylthreonylleucylarginylhistidyl…
onyllysylleucylisoleucylglutamylglycyl…
nylarginylvalylarginylalanylglutamylas…
rolylglycylprolylprolylcysteinylvalyls…
ylaspartylprolylphenylalanylglycylprol…
llysylprolylisoleucylvalylglutamylaspa…
rylmethionylleucylvalyllysyltryptophyl…
tylasparaginylglycylserylprolylisoleuc…
ylglutamyllysylarginylglutamylvalylasp…
phylserylarginylvalylasparaginyllysyls…
ucyllysylalanylasparaginylvalylasparty…
ucylthreonyltyrosylvalylphenylalanylar…
paraginylalanylalanylglycylprolylglycy…
serylaspartylprolyllysylthreonylalanyl…
lprolylprolylglycylprolylprolylisoleuc…
lthreonylserylserylthreonylthreonyliso…
hylglutamylprolylprolylalanylphenylala…
tamylisoleucylvalylglycyltyrosylphenyl…
eucylvalylglycylthreonylasparaginyllys…
reonylglutamyllysylmethionylisoleucyll…
reonylvalyllysylglutamylisoleucylargin…
yllysylleucylarginylvalylserylalanylva…
tamylglycylprolylprolylglycylglutamylt…
lvalylalanylglutamylprolylglutaminylgl…
ylleucylaspartylvalylserylvalyllysylgl…
cylmethionylalanylglycyllysylthreonyll…
lylvalylthreonylglycylarginylprolylval…
lthreonyllysylglutamylglutamylglycylgl…
ginylvalylvalylisoleucylaspartylaspara…
lutamylleucylisoleucylisoleucyllysylas…
tylhistidylglycylarginyltyrosylvalylis…
ginylserylcysteinylglycylseryllysylphe…
alylglutamylvalylphenylalanylaspartylv…
partylleucyllysylprolylvalylvalylthreo…
cysteinylleucylleucylasparaginyltrypto…
rtylaspartylglycylglycylserylglutamyli…
soleucylisoleucylglutamylarginyllysyla…
threonyltryptophylarginylglutaminylpro…
larginylseryllysylcysteinylaspartyliso…
tamylglycylglutaminylglutamyltyrosylly…
lalanyllysylasparaginyllysylphenylalan…
valylglutamylisoleucylglycylprolylisol…
lleucylglycylprolylprolylthreonylseryl…
tyrosylthreonylglutamylarginylglutamin…
onylleucylaspartyltryptophyllysylgluta…
cylglycylserylprolylisoleucylglutaminy…
tamyllysylarginylarginylhistidylaspart…
utamylarginylvalylasparaginyllysylargi…
eonylserylphenylalanylleucylvalylgluta…
lhistidylglutaminylmethionyltyrosylglu…
lanylvalylasparaginylglutamylisoleucyl…
rylleucylprolylleucylasparaginylvalylv…
rtylglutamylvalylprolylprolylthreonyli…
ylvalylarginylglycylaspartylthreonylis…
lutamylprolylvalylhistidylisoleucylpro…
lleucylprolylmethionylprolyllysylisole…
araginylglutamylthreonylvalylisoleucyl…
alanylleucylglutaminylisoleucylthreony…
inylserylglutamylalanyllysylthreonylgl…
ylalanylvalylarginylglutamylaspartylly…
ylthreonylalanylserylasparaginylarginy…
arginylasparaginylvalylhistidylvalylgl…
olylserylprolylprolylarginylasparaginy…
soleucyllysylalanylglutamylserylcystei…
spartylalanylprolylleucylaspartylaspar…
eucylthreonylhistidyltyrosylvalylisole…
nylserylarginyllysyllysylalanylglutamy…
eonylasparaginylthreonylalanylvalylglu…
ucyltryptophyllysylleucylisoleucylprol…
lglutamylphenylalanylarginylvalylargin…
lglycylisoleucylserylaspartylglutamylc…
lvalylisoleucylglutaminylaspartylproly…
olylprolylglycyllysylprolyllysylvalyll…
ylserylmethionylleucylvalylseryltrypto…
tylasparaginylglycylglycylserylprolyli…
phylleucylglutamyllysylarginylglutamyl…
ptophylserylarginylvalylserylarginylal…
ylglycylleucyllysylglycylvalylglutamyl…
rginylleucylleucylglutamylglycylvalyll…
ginylalanylmethionylalanylisoleucylasp…
glycylprolylprolylserylglutamylprolyls…
ylglycylaspartylprolylisoleucylphenyla…
serylcysteinylprolylglutamylvalyllysyl…
lisoleucylserylleucylglycyltryptophyll…
glycylglycylserylprolylisoleucyllysylg…
ethionylglutaminylglutamylglutamylglyc…
llysylarginylvalylasparaginylglutamylp…
reonylthreonylcysteinylglutamylcystein…
lysylglutamylleucylarginyllysyltyrosyl…
lalanylvalylasparaginylglutamylalanylg…
ylaspartylthreonylthreonylglycylglutam…
rtylisoleucylglutaminylglutamylglutamy…
leucylaspartylisoleucylglycylalanylglu…
cysteinyllysylalanylglycylserylglutami…
lanylvalylisoleucyllysylglycylarginylp…
ryptophylglutamylphenylalanylaspartylg…
hionyllysylaspartylglycylvalylhistidyl…
rtylalanylglutaminylleucylglutamylthre…
erylvalylisoleucylisoleucylisoleucylpr…
rylhistidylthreonylglycyllysyltyrosyls…
araginyllysylalanylglycylglutaminyllys…
larginylvalyllysylvalylmethionylaspart…
laspartylleucyllysylvalylserylaspartyl…
cysteinylarginylleucylseryltryptophyll…
aspartylglycylglycylaspartylarginyliso…
cylglutamyllysylarginylthreonylisoleuc…
ylthreonyllysylvalylasparaginylprolyla…
threonylphenylalanylvalylvalylprolylas…
aminylglutaminyltyrosylphenylalanylphe…
lutamylasparaginylarginylphenylalanylg…
ylglutamylthreonylisoleucylglutaminyla…
aspartylprolylisoleucyltyrosylprolylpr…
sylleucyllysylisoleucylglycylleucyliso…
nylvalylhistidylleucylseryltryptophyll…
artylglycylglycylserylprolylvalylthreo…
tamylcysteinylleucylalanyltryptophylas…
ysyllysylglutamylalanyltryptophylargin…
ylarginylaspartylvalylglutamylglutamyl…
lvalylglutamylaspartylleucylvalylgluta…
mylphenylalanylarginylvalyllysylalanyl…
alylseryllysylprolylserylalanylthreony…
cysteinylglutaminylarginylprolylaspart…
ylaspartylleucyllysylglutamylphenylala…
utamylglycylthreonylasparaginylvalylas…
soleucyllysylglycylvalylprolylphenylal…
ptophylphenylalanyllysylalanylprolylpr…
inyllysylglutamylprolylvalylleucyltyro…
araginyllysylleucylvalylvalylaspartyla…
cylvalylisoleucylprolylglutaminylseryl…
glycylleucyltyrosylthreonylisoleucylth…
inylleucylglycylthreonylalanylseryllys…
araginylvalylleucylglycylarginylprolyl…
isoleucyllysylphenylalanylglutamylsery…
methionylthreonylleucylseryltryptophyl…
ylaspartylglycylglycylseryllysylisoleu…
soleucylglutamyllysylarginylglutamylal…
tryptophylvalylhistidylvalylserylseryl…
lthreonyltyrosylthreonylisoleucylproly…
tidylglutamyltyrosylvalylphenylalanyla…
minylasparaginyllysyltyrosylglycylisol…
rtylserylglutamylprolylglutamylthreony…
ylalanylserylvalylprolylglycylalanylpr…
lserylserylvalylthreonylarginylasparag…
raginyltryptophylglutamylglutamylproly…
lserylprolylvalylthreonylglycyltyrosyl…
sylaspartylthreonylthreonylseryllysyla…
paraginylarginylaspartylprolylisoleucy…
glycylvalylseryltyrosyllysylvalylthreo…
cylserylaspartyltyrosylglutaminylpheny…
leucylasparaginylalanylalanylglycylval…
ylserylaspartylprolylalanylthreonylala…
anylprolylprolylglycylprolylprolylphen…
artyltryptophylthreonyllysylserylseryl…
hylserylprolylprolylleucyllysylasparty…
lglycyltyrosylisoleucylvalylglutamylty…
ylglutamylglutamyltryptophylglutamylly…
valylarginylglycylthreonyllysylleucylv…
lutamylglycylalanylphenylalanyltyrosyl…
lanylvalylasparaginylisoleucylalanylgl…
ycylglutamylvalylthreonylaspartylvalyl…
rtylarginylleucylvalylserylprolylaspar…
anylserylvalylarginylaspartylarginylis…
ylglycylvalylisoleucylarginylisoleucyl…
cyllysylprolylprolylprolylthreonylvaly…
onylasparaginylglutamylarginylthreonyl…
lthreonylisoleucylglutamylthreonylthre…
ethionylvalylisoleucyllysylasparaginyl…
idylglutaminylglycylvalyltyrosylseryll…
utamylalanylglycylglutamylarginyllysyl…
laspartylvalylleucylaspartylvalylproly…
lylphenylalanylleucylalanylhistidylasp…
utamylserylcysteinyllysylleucylthreony…
lutamylaspartylaspartylglycylglycylser…
ltyrosylvalylisoleucylglutamyllysylarg…
inylalanyltryptophylthreonylprolylvaly…
ylarginylglutaminylasparaginylalanylth…
oleucylglutaminylglycyllysylalanyltyro…
soleucylalanylalanylglutamylasparaginy…
lprolylphenylalanylvalylglutamylthreon…
leucylarginylglutamylprolylisoleucylth…
lylglutamylaspartylleucylglutamylvalyl…
raginylthreonylvalylthreonylleucylthre…
yllysyltyrosylaspartylglycylglycylsery…
nyltyrosylvalylleucylglutamylserylargi…
tamyllysylphenylalanylhistidyllysylval…
ginylleucylleucylserylarginyllysyltyro…
sylglutamylglycylaspartylthreonyltyros…
lanylvalylasparaginylisoleucylvalylgly…
phenylalanylcysteinylthreonyllysylprol…
partylglutamylleucylalanylprolylprolyl…
lphenylalanylarginylaspartyllysylleucy…
lglutamylalanylphenylalanylalanylleucy…
lycyllysylprolyllysylprolyllysylvalyls…
rtylglutamylalanylaspartylvalylleucylg…
nylhistidylisoleucyllysylthreonylthreo…
leucylglutamyllysylisoleucyllysylalany…
yllysyltyrosylcysteinylvalylvalylvalyl…
cylserylarginyllysylglycylphenylalanyl…
valylvalylaspartylhistidylprolylglycyl…
erylphenylalanylaspartylglutamylvalylt…
lvalylisoleucylseryltryptophyllysylpro…
ylglycylseryllysylisoleucylthreonylasp…
utamyllysyllysylglutamylvalylglycyllys…
rolylvalylthreonylserylalanylserylalan…
ylvalylseryllysylleucylleucylglutamylg…
henylalanylarginylisoleucylhistidylala…
glycylisoleucylserylaspartylprolylleuc…
ysylalanyllysylaspartylarginylphenylal…
lprolylaspartylglutaminylprolylisoleuc…
llysylaspartylserylalanylleucylvalylth…
lylhistidylaspartylglycylglycyllysylpr…
osylisoleucylleucylglutamyllysylarginy…
larginyltryptophylalanylarginylvalylth…
istidylprolyltyrosylthreonyllysylpheny…
ucylleucylglutamylglycylcysteinylgluta…
inylvalylserylalanylglutamylasparaginy…
ycylaspartylprolylserylprolylprolylser…
llysylaspartylprolylisoleucylalanyllys…
aginylprolylglutamylalanylisoleucylasp…
aginylserylvalylaspartylleucylthreonyl…
inylhistidylaspartylglycylglycylseryll…
leucylvalylglutamyltyrosylglutaminylly…
myltryptophylarginylarginylalanylaspar…
lserylcysteinylprolylglutamylthreonyll…
leucylarginylaspartylglycylglutaminylt…
nylvalylleucylalanylvalylasparaginylal…
ylprolylalanylhistidylvalylprolylgluta…
tylarginylleucylglutamylprolylprolylgl…
alanylasparaginylmethionylalanylarginy…
llysylvalylglycylaspartylthreonylleucy…
soleucyllysylglycylvalylprolylphenylal…
hyllysyllysylglutamylaspartylarginylas…
ylarginylisoleucylaspartylvalylthreony…
lutamylisoleucylarginylasparaginylalan…
cylglycylisoleucyltyrosylserylleucylth…
lalanylglycylseryllysylthreonylvalylse…
aspartyllysylprolylglycylprolylprolyla…
rylglutamylisoleucylarginyllysylaspart…
yltryptophyllysylglutamylprolylleucyla…
ylisoleucylthreonylasparaginyltyrosylv…
rtylvalylalanylserylalanylglutaminyltr…
lthreonylseryllysyllysyllysylserylhist…
leucylasparaginylglutamylglycylasparag…
anylarginylvalylalanylalanylglutamylas…
inylglycylprolylphenylalanylvalylgluta…
yllysylalanylleucylaspartylprolylleucy…
olyllysylaspartylleucylhistidylhistidy…
eonylglutamylvalylserylleucylvalyltryp…
larginylaspartylglycylglycylserylproly…
ylvalylglutamyltyrosylglutaminylglutam…
spartyltryptophylisoleucyllysylphenyla…
raginylleucylglutamylcysteinylvalylval…
taminylglycyllysylthreonyltyrosylargin…
ylglutamylasparaginylisoleucylvalylgly…
threonylthreonylisoleucylprolylisoleuc…
yllysylleucylvalylprolylprolylserylval…
eucylisoleucylglutamylglycylleucylvaly…
onylvalylarginylphenylalanylprolylalan…
lylprolylvalylprolylthreonylalanyllysy…
glycylserylglutamylisoleucyllysylthreo…
hreonylvalylglutamylthreonylaspartylas…
lleucylthreonylisoleucyllysylasparagin…
rtylthreonylglycylglutamyltyrosylgluta…
araginylalanylalanylglycylseryllysylth…
lthreonylvalylleucylaspartylvalylproly…
olylisoleucylasparaginylisoleucylleucy…
lhistidylmethionylthreonylisoleucylser…
ysylaspartylaspartylglycylglycylserylp…
ylisoleucylvalylglutamyllysylglutaminy…
ylthreonyltryptophylglycylvalylvalylse…
yllysylleucyllysylisoleucylprolylhisti…
inylglutamyltyrosylvalylphenylalanylar…
raginyllysylisoleucylglycylvalylglycyl…
onylprolylthreonylvalylalanyllysylhist…
lylserylprolylprolylglycyllysylprolylv…
hreonylglutamylasparaginylalanylalanyl…
lleucylprolyllysylserylaspartylglycylg…
ycyltyrosyltyrosylmethionylglutamylarg…
cyllysyltryptophylvalylarginylvalylasp…
lalanylaspartylleucyllysylphenylalanyl…
osylglutamylglycylasparaginylthreonylt…
lylphenylalanylalanylglutamylasparagin…
lprolylserylprolylserylserylaspartylpr…
ginylprolylisoleucyllysylprolylprolylg…
ylprolyllysylleucyllysylaspartyllysyls…
partylleucylvalyltryptophylthreonyllys…
ycylserylprolylisoleucylleucylglycylty…
taminyllysylprolylglycylthreonylalanyl…
nylisoleucylasparaginyllysylaspartylgl…
nylcysteinylalanylphenylalanylarginylv…
amylglycylasparaginylglutamyltyrosylar…
sylalanylalanylasparaginylisoleucylval…
larginylglutamylleucylalanylglutamylse…
lisoleucylleucylhistidylprolylprolylgl…
lylthreonylcysteinylarginylaspartylval…
lglycylglutaminylthreonylisoleucylargi…
llysylglycylarginylprolylglutamylproly…
lthreonyllysylglutamylglycyllysylvalyl…
nylvalylaspartylleucylisoleucylglutami…
glutamylleucylglutaminylisoleucyllysyl…
artylhistidylglycyllysyltyrosylisoleuc…
nylserylserylglycylhistidylalanylgluta…
lasparaginylvalylleucylaspartylarginyl…
ylasparaginylleucyllysylvalylthreonyla…
lasparaginylcysteinylthreonylisoleucyl…
rolylleucylaspartylasparaginylglycylgl…
sparaginylphenylalanylisoleucylvalylgl…
raginylglutaminyllysylglycyltryptophyl…
tylvalylthreonyllysylarginylleucylisol…
ucylalanylasparaginylasparaginylglutam…
valylcysteinylalanylglutamylasparaginy…
hreonylisoleucylglutamylthreonyllysylt…
soleucylasparaginylprolylisoleucylaspa…
ylglutamylasparaginylleucylhistidyliso…
lthreonylphenylalanylvalyltyrosylleucy…
laspartyltyrosylaspartylglycylglycylse…
sylhistidylvalylglutamylarginylarginyl…
tyltryptophylglutamylarginylvalylhisti…
utamylthreonylhistidyltyrosylmethionyl…
lutamylasparaginylglutaminylisoleucylt…
lylglutaminylthreonyllysylasparaginylg…
artyltryptophylvalyllysylthreonylgluta…
amylaspartylleucylglutaminyllysylproly…
ylserylglycylvalylleucylthreonylvalyll…
leucylarginylleucylglutamylalanylglycy…
lalanylprolylglutamylvalylalanyltrypto…
tylalanylthreonylaspartylleucylthreony…
lisoleucylaspartylthreonylarginylalany…
lserylleucylthreonyllysylalanyllysylar…
tyrosylvalylvalylthreonylalanylthreony…
ylphenylalanylvalylalanyltyrosylalanyl…
aspartyllysylprolylglycylprolylvalylar…
lvalylaspartylvalylserylserylaspartyla…
yltryptophylaspartylprolylprolylglutam…
inylglutamylisoleucylglutaminylasparag…
ysylcysteinylglutamylthreonyllysylargi…
eonyltyrosylserylalanylthreonylvalylle…
eonylvalylthreonylarginylleucylisoleuc…
tyrosylisoleucylphenylalanylarginylval…
ysylisoleucylglycylthreonylglycylproly…
olylvalylisoleucylalanyllysylthreonyll…
larginylprolylaspartylprolylprolylglut…
ylglutamylglutamylmethionylthreonylval…
rolylglutamyltyrosylaspartylglycylglyc…
tyrosylphenylalanylleucylglutamyllysyl…
onylarginyltryptophylvalylprolylvalyla…
prolylglutamylarginylarginylmethionyll…
lleucylprolylaspartylhistidylglutamylt…
valyllysylalanylglutamylasparaginylglu…
glutamylprolylserylleucylprolylserylar…
artylprolylisoleucylglutamylprolylprol…
inylphenylalanylarginylvalylvalylaspar…
ylisoleucylthreonylleucylglycyltryptop…
artylglycylglycylalanylprolylisoleucyl…
tamylmethionylarginylprolyllysylisoleu…
spartylglutamylglycyltryptophyllysylar…
ylalanylglutaminylleucylvalylarginylly…
lthreonylserylleucylaspartylglutamylas…
lutamylphenylalanylarginylvalylcystein…
inylvalylglycylisoleucylglycylarginylp…
mylalanylisoleucyllysylprolyllysylglut…
olylglutamylisoleucylaspartylleucylasp…
ylleucylvalylisoleucylvalylarginylalan…
inylleucylphenylalanylalanylisoleucylv…
lprolyllysylvalylthreonyltryptophylarg…
ylasparaginylvalylvalylarginyllysylgly…
ylaspartylthreonylmethionylalanylpheny…
paraginylserylthreonylarginylaspartyla…
leucylthreonylleucylvalylasparaginylpr…
valylphenylalanylvalylasparaginylvalyl…
rolylglycylprolylvalylserylaspartylleu…
onyllysylthreonylserylcysteinylhistidy…
olylglutamylasparaginylaspartylglycylg…
stidyltyrosylisoleucylvalylglutamyllys…
nyllysylthreonyltryptophylserylthreony…
syllysylthreonylserylphenylalanylhisti…
lylprolylglycylasparaginylglutamyltyro…
hreonylalanylvalylasparaginylglutamylt…
threonylaspartylvalylprolyllysylprolyl…
lleucylserylglutamylprolylaspartylprol…
lanylthreonylglutamylmethionylthreonyl…
leucylalanyltryptophylleucylprolylprol…
alanyllysylisoleucylaspartylglycyltyro…
ginylglutamylglutamylglutamylglutaminy…
hylthreonylglutamyltyrosylserylvalylva…
lylvalylthreonylglycylleucyllysylgluta…
ylalanylarginylvalylalanylalanylarginy…
erylleucylprolylarginylglutamylalanylg…
anyllysylglutamylglutaminylleucylleucy…
thionylprolylglutamylglutaminylisoleuc…
llysyllysylleucylarginylisoleucylgluta…
lysylprolylhistidylprolylthreonylcyste…
glutamylaspartylglutamylvalylvalylthre…
alylhistidyllysylalanylaspartylserylse…
leucyllysylaspartylvalylthreonylarginy…
osylserylleucylthreonylalanylglutamyla…
spartylthreonylglutaminyllysylisoleucy…
tylalanylprolylglycylprolylprolylgluta…
ylisoleucylserylaspartylisoleucylaspar…
ylleucylseryltryptophylhistidylisoleuc…
lglycylserylasparaginylisoleucylthreon…
lutamyllysylcysteinylaspartylvalylsery…
ylthreonylalanylleucylalanylserylvalyl…
arginylvalylglycyllysylleucylisoleucyl…
ylisoleucylphenylalanylarginylvalylarg…
lphenylalanylglycylisoleucylserylgluta…
ysylmethionylvalylalanylglutaminylphen…
ylprolylserylglutamylprolyllysylaspara…
lvalylasparaginyllysylaspartylcysteiny…
yptophylaspartylarginylprolylaspartyls…
isoleucylisoleucylglycyltyrosylleucyli…
larginylasparaginylserylleucylleucyltr…
aspartylthreonylleucylvalylarginylsery…
inylalanylglycylleucylvalylglutamylgly…
alanylarginylisoleucyltyrosylalanylleu…
lserylprolylprolylseryllysylprolylthre…
nylarginylmethionylprolylvalylaspartyl…
ylvalylisoleucylaspartylvalylthreonyll…
oleucyltryptophylalanylarginylprolylly…
llysylisoleucylisoleucylglycyltyrosylp…
inyllysylleucylprolylglycylaspartyllys…
paraginylthreonylalanylprolylhistidylg…
lutamylglutamyltyrosylthreonylalanylth…
ysylalanylglutaminyltyrosylglutaminylp…
anylarginylthreonylalanylvalylasparagi…
lutamylprolylserylaspartylprolylvalylt…
lasparaginylvalylprolylprolylarginylis…
ylmethionyllysylserylleucylleucylthreo…
paraginylvalylcysteinylleucylaspartyla…
llysylprolylmethionylprolylthreonylval…
glycylthreonylleucylleucyllysylprolyla…
thionylalanylmethionylglutaminylarginy…
leucylglutamylleucylphenylalanylserylv…
serylglycylaspartyltyrosylthreonylisol…
nylserylserylglycylseryllysylserylalan…
valylleucylaspartyllysylprolylglycylpr…
eucylasparaginyllysylmethionyltyrosyls…
eucylseryltryptophylglutamylprolylprol…
lserylglutamylisoleucylthreonylasparag…
sylarginylglutamylthreonylserylarginyl…
utaminylvalylserylalanylthreonylvalylp…
lserylvalylglutamyllysylleucylisoleucy…
sylglutaminylphenylalanylarginylisoleu…
yllysyltyrosylglycylvalylglycylasparty…
tamylprolylalanylisoleucylalanyllysyla…
ylprolylglycylarginylcysteinylaspartyl…
raginylisoleucylthreonyllysylaspartylh…
ryptophyllysylprolylprolylalanylaspart…
oleucylthreonylglycyltyrosylleucylleuc…
nylglutaminylalanylvalylasparaginyltry…
larginyllysylprolylisoleucylisoleucylg…
anylthreonylglycylleucylglutaminylglut…
utamylphenylalanylarginylvalylthreonyl…
ylglycylprolylglycyllysylprolylserylas…
yrosylalanylarginylaspartylprolylgluta…
lprolylalanylphenylalanylprolyllysylva…
rginylserylserylvalylserylleucylserylt…
osylaspartylglycylglycylserylprolyliso…
alylglutamylvalyllysylarginylalanylasp…
phylvalylarginylcysteinylasparaginylle…
ylglutaminyllysylthreonylarginylphenyl…
ucylmethionylglutamylaspartylthreonylg…
nylarginylvalyltyrosylalanylvalylaspar…
rylaspartylprolylserylaspartylvalylpro…
yllysylaspartylisoleucylleucylisoleucy…
histidylaspartylalanylaspartylleucylar…
ucylarginylalanylglycylvalylthreonylme…
lylvalyllysylglycylarginylprolylprolyl…
hylseryllysylprolylasparaginylvalylasp…
lisoleucylglycylleucylaspartylisoleucy…
anylaspartylthreonylphenylalanylleucyl…
valylasparaginyllysyltyrosylaspartylal…
ylthreonylleucylglutamylasparaginylser…
tyrosylthreonylisoleucylvalylvalyllysy…
lycylprolylprolylisoleucylasparaginylv…
ucylseryllysylaspartylserylalanyltyros…
olylprolylisoleucylisoleucylaspartylgl…
ucylasparaginyltyrosylvalylvalylglutam…
mylarginyllysylseryltryptophylserylthr…
ysteinylseryllysylthreonylserylphenyla…
eucylglutamylglutamylglycyllysylserylt…
ylvalylphenylalanylalanylglutamylaspar…
lglycylaspartylprolylglycylglutamylthr…
lalanylserylglutaminylthreonylprolylgl…
ysylvalylarginylserylvalylseryllysylse…
yltryptophyllysyllysylprolylhistidylse…
isoleucylisoleucylglycyltyrosylvalylva…
ylglutamylglutamylasparaginyllysyltryp…
yllysylserylleucylserylleucylglutaminy…
cylthreonylglutamylglycyllysylglutamyl…
alylserylalanylglutamylasparaginylglut…
threonylprolylserylglutamylisoleucylth…
ylaspartylvalylvalylalanylprolylaspart…
ucylprolylaspartylleucylcysteinyltyros…
nylserylasparaginylphenylalanylarginyl…
lysylglycyllysylprolylalanylprolylsery…
ylglutamylaspartylprolylleucylalanylth…
erylvalylglutamylserylserylalanylvalyl…
oleucylvalyltyrosylaspartylcysteinylgl…
cyllysyltyrosylthreonylisoleucylthreon…
glycylthreonyllysylglutamylglycylthreo…
lvalylglycyllysylprolylglycylisoleucyl…
lysylphenylalanylaspartylglutamylvalyl…
ylthreonylleucyllysyltryptophylalanylp…
cylglycylserylglutamylisoleucylthreony…
lutamyllysylarginylaspartylserylvalyla…
lvalylthreonylcysteinylalanylserylalan…
nylphenylalanylarginylvalylthreonylarg…
hionylglutamyltyrosylthreonylphenylala…
sparaginyllysyltyrosylglycylvalylglycy…
amylprolylisoleucylvalylalanylarginylh…
lylprolylaspartylalanylprolylprolylpro…
spartylvalylarginylhistidylaspartylser…
lthreonylaspartylprolyllysyllysylthreo…
threonylglycyltyrosylhistidylleucylglu…
ylasparaginylserylleucylleucyltryptoph…
lthreonylprolylisoleucylarginylmethion…
alylthreonylglycylleucylthreonylglutam…
ylphenylalanylarginylvalylmethionylala…
glycylvalylglycyllysylprolylserylleucy…
lalanylleucylaspartylprolylisoleucylas…
glutamylvalylisoleucylasparaginylisole…
valylthreonylleucylisoleucyltryptophyl…
spartylglycylglycylhistidyllysylleucyl…
glutamyllysylarginylaspartylleucylprol…
llysylalanylasparaginylhistidylvalylas…
ylalanylphenylalanylthreonylvalylthreo…
lglycyllysyltyrosylglutamylphenylalany…
asparaginylthreonylalanylglycylalanyli…
mylserylthreonylglutamylthreonylisoleu…
lutamyltyrosylglutamylalanylprolylthre…
lylthreonylisoleucyllysylaspartylglycy…
glycylaspartylthreonylisoleucylvalylle…
isoleucylleucylglycyllysylprolylleucyl…
llysylalanylglycyllysylaspartylisoleuc…
ylthreonylglutaminylisoleucylthreonyls…
lmethionylleucylthreonylisoleucyllysyl…
partylalanylglycylglutamyltyrosylthreo…
sparaginylprolylphenylalanylglycylthre…
lysylvalylthreonylvalylleucylaspartylv…
rolylvalylglutamylisoleucylserylaspara…
lanylthreonylleucylthreonyltryptophylt…
partylglycylglycylserylprolylisoleucyl…
tamyllysylarginylglutamylthreonylseryl…
ylvalylvalylserylglutamylaspartylisole…
histidylvalylalanylthreonyllysylleucyl…
lglutamyltyrosylisoleucylphenylalanyla…
nylhistidyltyrosylglycyllysylglycylglu…
amylprolylvalyllysylmethionylvalylaspa…
prolylglycylprolylprolylglutamyllysylp…
alylthreonyllysylasparaginylthreonylal…
ylarginylprolylvalylaspartylaspartylgl…
eonylglycyltyrosylhistidylvalylglutamy…
rylleucylarginyltryptophylvalylarginyl…
alylserylaspartylleucylarginylcysteiny…
aminylglutamylglycylserylthreonyltyros…
erylalanylglutamylasparaginylarginylal…
ylserylglutamylalanylserylaspartylsery…
lanylalanyltyrosylprolylprolylglycylpr…
tidylvalylthreonylaspartylthreonylthre…
lalanyltryptophylglycyllysylprolylhist…
ylglutamylisoleucylthreonylglycyltyros…
nyllysylvalylglycylaspartylglutamylala…
threonylthreonylglycylthreonylalanylle…
nylphenylalanylvalylvalylprolylasparty…
myllysyltyrosylasparaginylphenylalanyl…
lasparaginylaspartylalanylglycylvalylg…
ucylprolylaspartylvalylglutamylisoleuc…
onylalanylprolylaspartylphenylalanylgl…
eucylarginylarginylthreonylleucylvalyl…
isoleucylarginylisoleucylphenylalanylv…
ylprolylalanylprolylglutamylvalylthreo…
sparaginylisoleucylasparaginylleucylly…
nylisoleucylglutamylasparaginylthreony…
eucylleucylisoleucylisoleucylprolylglu…
osylaspartylthreonylglycyllysylphenyla…
lglutamylasparaginylprolylalanylglycyl…
lylasparaginylvalylarginylvalylleucyla…
lylleucylasparaginylleucylarginylproly…
ysylaspartylserylvalylthreonylleucylhi…
lleucylisoleucylaspartylglycylglycylse…
nyltyrosylisoleucylvalylglutamyllysyla…
lysylseryltyrosylserylthreonylalanylth…
llysylcysteinylthreonyltyrosyllysylval…
glycylcysteinylglutamyltyrosylphenylal…
ylalanylglutamylasparaginylglutamyltyr…
olylthreonylglutamylthreonylthreonylgl…
utamylalanylprolylserylprolylprolylasp…
lmethionylaspartylisoleucylthreonyllys…
yltryptophylprolyllysylprolyllysylhist…
soleucylthreonylglycyltyrosylvalylisol…
llysylglycylserylaspartylglutaminyltry…
eonylthreonylvalyllysylglycylleucylglu…
raginylleucylthreonylglutamylglycylglu…
lanylglutaminylvalylmethionylalanylval…
ylserylalanylprolylarginylglutamylsery…
sylglutamylglutaminylthreonylmethionyl…
eucylarginylglycylisoleucyltyrosylglut…
yllysylalanylglycylaspartylasparaginyl…
lprolylvalylleucylglycylarginylprolyll…
tophyllysyllysylglycylaspartylglutamin…
eonylglutaminylarginylvalylasparaginyl…
lalanylthreonylserylthreonylisoleucyll…
lglutamylcysteinylvalylarginylserylasp…
leucylthreonylalanylarginylasparaginyl…
ycylaspartylvalylisoleucylthreonylisol…
lisoleucylprolylglycylprolylprolylthre…
lalanylaspartylglutamylvalylserylseryl…
enylalanylseryltryptophylaspartylproly…
lycylglycylvalylprolylisoleucylserylas…
ethionylarginylglutaminylthreonylaspar…
alylglutamylleucylalanylthreonylthreon…
onyltyrosyllysylalanylthreonylarginyll…
utamyltyrosylglutaminylphenylalanylarg…
aginylarginyltyrosylglycylvalylglycylp…
anyltryptophylisoleucylvalylalanylaspa…
ylvalylprolylglycylprolylprolylglycylt…
lalanylvalylthreonyllysylaspartylseryl…
tophylhistidylglutamylprolylleucylsery…
leucylleucylglycyltyrosylhistidylvalyl…
asparaginylglycylisoleucylleucyltrypto…
ylalanylleucylvalylprolylglycylasparag…
serylglycylleucylthreonylaspartylglycy…
ylalanylarginylvalylisoleucylalanylglu…
yllysylseryllysylprolylseryllysylproly…
alanylleucylaspartylprolylisoleucylasp…
alylprolylleucylasparaginylisoleucylth…
hreonylleucyllysyltryptophylalanyllysy…
lglycylphenylalanyllysylisoleucylthreo…
yllysylarginylaspartylleucylprolylaspa…
llysylalanylasparaginylphenylalanylser…
lasparaginylglutamylphenylalanylthreon…
tamylaspartylalanylalanyltyrosylglutam…
alanyllysylasparaginylalanylalanylglyc…
erylglutamylprolylserylaspartylalanyli…
artylaspartylvalylglutamylalanylprolyl…
yllysylphenylalanyllysylaspartylthreon…
ycylglutamylalanylphenylalanylarginyll…
ylglycylarginylprolylprolylprolylthreo…
lysylaspartylglycyllysylglutamylleucyl…
ucylglutamylisoleucyllysylisoleucylala…
lasparaginylleucylvalylasparaginyllysy…
laspartylserylglycylalanyltyrosylthreo…
raginylprolylglycylglycylphenylalanyla…
anylasparaginylvalyllysylvalylleucylas…
ylglutamylglycylprolylleucylalanylvaly…
glutamyllysylcysteinylvalylleucylseryl…
eucylaspartylaspartylglycylglycylalany…
sylisoleucylvalylglutaminyllysylarginy…
alanyltryptophylthreonylasparaginylval…
lvalylthreonyllysylleucyllysylvalylthr…
paraginylglutamyltyrosylisoleucylpheny…
alylasparaginyllysyltyrosylglycylvalyl…
erylglutamylprolylvalylleucylalanylval…
lylprolylaspartylprolylprolyllysylaspa…
hreonylisoleucylthreonyllysylaspartyls…
ptophylglycylhistidylprolylaspartylser…
isoleucylisoleucylasparaginyltyrosylis…
spartyllysylalanylglycylglutaminylargi…
lasparaginyllysyllysylthreonylleucylth…
ysylvalylserylglycylleucylthreonylglut…
utamylphenylalanylarginylisoleucylmeth…
lalanylglycylisoleucylserylalanylproly…
ylalanyltyrosyllysylalanylcysteinylasp…
prolylglycylprolylprolylglycylasparagi…
threonylserylarginylserylserylisoleucy…
raginyllysylprolylisoleucyltyrosylaspa…
cylthreonylglycyltyrosylmethionylvalyl…
glutamylglutamylaspartylglutamyltrypto…
lprolylprolylalanylglycylleucyllysylal…
leucylthreonylglycylleucylthreonylglut…
rosyllysylisoleucylarginylisoleucyltyr…
glutamylglycylleucylglycylglutamylprol…
onylprolyllysylalanylglutamylaspartyla…
utamylisoleucylglutamylleucylaspartyla…
lvalylthreonylisoleucylarginylalanylcy…
ylleucylphenylalanylvalylprolylisoleuc…
rolylglutamylvalyllysyltryptophylalany…
mylserylleucylaspartyllysylalanylseryl…
ryltyrosylthreonylleucylleucylisoleucy…
inylarginylphenylalanylaspartylserylgl…
onylvalylglutamylasparaginylserylseryl…
anylvalylasparaginylvalylarginylvalyll…
olylprolylglutaminylaspartylleucyllysy…
ylthreonylserylvalylthreonylleucylthre…
eucylleucylaspartylglycylglycylserylly…
isoleucylvalylglutamyllysylarginylglut…
tyrosylserylthreonylvalylalanylthreony…
hreonylseryltryptophyllysylvalylaspart…
lglycylcysteinylseryltyrosyltyrosylphe…
utamylasparaginylglutamyltyrosylglycyl…
utamylthreonylalanylglutamylserylvalyl…
ylleucylprolylprolylglycyllysylisoleuc…
lylthreonylarginylasparaginylserylvaly…
lysylprolylglutamylhistidylaspartylgly…
lglycyltyrosylisoleucylvalylglutamylme…
lserylaspartyllysyltryptophylalanylthr…
sylvalylthreonylglutamylalanylthreonyl…
cylglutaminylglycylglutamylglutamyltyr…
rylalanylglutaminylasparaginylglutamyl…
olylarginylglutaminylleucylserylvalylp…
tylleucylvalylisoleucylprolylprolylala…
nylalanylasparaginylthreonylphenylalan…
utamylaspartylleucyllysylvalylaspartyl…
cylarginylprolylthreonylprolylalanylva…
spartylasparaginylvalylprolylleucyllys…
valylasparaginylalanylglutamylserylthr…
serylleucylleucylthreonylisoleucyllysy…
amylaspartylvalylglycylhistidyltyrosyl…
ginylserylalanylglycylglutamylalanylis…
ginylvalylisoleucylvalylleucylaspartyl…
ylglycylprolylvalyllysylmethionylaspar…
tylserylisoleucylthreonylleucylseryltr…
sylaspartylglycylglycylserylserylisole…
oleucylvalylglutamyllysylarginylaspart…
onyltryptophylglutaminylisoleucylvalyl…
ylthreonylthreonylisoleucyllysylalanyl…
glycylcysteinylglutamyltyrosylglutamin…
lalanylglutamylasparaginylarginyltyros…
ucylasparaginylserylglutamylprolylthre…
lylphenylalanyllysylvalylprolylglycylp…
lvalylthreonylleucylserylserylarginyla…
lutaminyltryptophylasparaginylglutamyl…
lycylserylarginylvalylisoleucylglycylt…
lysylglutamylarginylasparaginylserylis…
ucylasparaginyllysylthreonylprolylisol…
henylalanyllysylthreonylthreonylglycyl…
utamyltyrosylglutamylphenylalanylargin…
ylisoleucylvalylglycylisoleucylglycyll…
mylcysteinyltyrosylvalylalanylarginyla…
lprolylglycylarginylprolylglutamylalan…
ginylasparaginylserylvalylthreonylleuc…
lylthreonyltyrosylaspartylglycylglycyl…
rosylisoleucylvalylglutamyllysyllysylg…
ginyltryptophylmethionyllysylalanylser…
oleucylisoleucylaspartylthreonylhistid…
glycylleucylvalylglutamylaspartylhisti…
ylarginylvalylisoleucylalanylarginylas…
nylalanylserylglutamylprolylserylgluta…
ylthreonylalanylarginylaspartylglutamy…
oleucylserylmethionylaspartylprolyllys…
ucylvalylvalylhistidylalanylglycylglut…
rtylalanylaspartylisoleucyltyrosylglyc…
lisoleucylglutaminyltryptophylisoleucy…
mylleucylserylasparaginylthreonylalany…
lserylthreonylaspartylphenylalanylalan…
laspartylalanylvalylarginylvalylaspart…
eucylleucyllysylalanyllysylasparaginyl…
ylvalylthreonylvalylasparaginylvalylly…
glycylprolylprolylglutamylglycylprolyl…
threonylalanylglutamyllysylcysteinylth…
olylprolylleucylglutaminylaspartylglyc…
ucylasparaginyltyrosylisoleucylvalylgl…
lserylarginylleucylvalyltryptophylthre…
inylvalylglutaminylthreonylleucylseryl…
cylleucylglutamylglycylasparaginylglut…
nylisoleucylmethionylalanylvalylaspara…
lutamylprolylleucylglutamylserylglutam…
ginylprolylphenylalanylvalylvalylproly…
lylglutamylvalylthreonylthreonylvalylt…
soleucylvalylvalyltryptophylglutamylar…
lglycylserylglutamylisoleucylleucylgly…
rginylaspartyllysylglutamylglycylisole…
lcysteinylhistidyllysylarginylleucylis…
eucylarginylvalylthreonylglycylleucyli…
aspartyltyrosylglutamylphenylalanylarg…
inylalanylalanylglycylleucylserylgluta…
yltyrosylglutaminyllysylalanylcysteiny…
lprolylglycylprolylprolylasparaginylas…
spartylisoleucylthreonylarginylserylse…
tophylseryllysylprolylisoleucyltyrosyl…
ylisoleucylglutaminylglycyltyrosylisol…
artylvalylasparaginylvalylglycylglutam…
nylthreonylprolylprolylthreonylglycyli…
araginylisoleucylglutamylvalylglutamyl…
dylglutamyltyrosylasparaginylphenylala…
soleucylasparaginyllysylalanylglycylva…
rtylvalylprolylglycylprolylisoleucylis…
ucylglutamylalanylprolylaspartylisoleu…
amylleucylarginyllysylisoleucylisoleuc…
glycylglycylserylleucylarginylleucylph…
glycylarginylprolylthreonylprolylgluta…
alylaspartylglycylglutamylisoleucylarg…
oleucylaspartylvalylthreonylserylseryl…
lleucylaspartylasparaginylvalylasparag…
yllysyltyrosylthreonylleucylthreonylle…
ycylthreonyllysylserylalanylphenylalan…
cylaspartylthreonylprolylserylprolylpr…
lthreonylglutamylisoleucylthreonyllysy…
reonyltryptophylglutamylprolylprolylle…
lysylisoleucyllysylasparaginyltyrosyli…
utamylalanylthreonylarginyllysylserylt…
lasparaginylcysteinylhistidyllysylaspa…
laspartylglutaminylleucylglutaminylglu…
osylphenylalanylarginylvalylthreonylal…
sylglycylisoleucylglycylleucylprolylal…
lprolylisoleucyllysylvalylalanylglutam…
glycyllysylisoleucylthreonylvalylaspar…
raginylserylvalylserylleucylseryltrypt…
tidylaspartylglycylglycylseryllysyliso…
leucylvalylglutamylmethionylglutaminyl…
yltryptophylserylglutamylcysteinylalan…
minylalanylvalylisoleucylthreonylaspar…
lglutamylglutamyltyrosylleucylphenylal…
araginylglutamyllysylglycylarginylsery…
anylvalylprolylisoleucylvalylalanyllys…
mylprolylaspartylvalyllysylprolylalany…
valylglutaminylvalylglycylglutaminylas…
alylprolylisoleucylserylglycylarginylp…
reonyltryptophylthreonyllysylaspartylg…
nylthreonylthreonylarginylisoleucylasp…
eucylaspartylleucylthreonylthreonylleu…
nylhistidyllysylaspartylaspartylglycyl…
cylthreonylvalylalanylasparaginylvalyl…
lanylserylisoleucylglutamylisoleucylva…
laspartylprolylprolyllysylglycylprolyl…
tylvalylserylalanylglutamylserylisoleu…
araginylprolylprolylleucyltyrosylthreo…
soleucylthreonylasparaginyltyrosylisol…
artylthreonylthreonylthreonylthreonylv…
ylalanylthreonylvalylalanylarginylthre…
llysylleucyllysylthreonylglycylthreony…
nylarginylisoleucylphenylalanylalanylg…
cylglutaminylserylphenylalanylalanylle…
eucylvalylalanylglutaminyltyrosylproly…
olylprolylglycylthreonylprolylphenylal…
ryllysylaspartylserylmethionylvalyliso…
lutamylprolylvalylasparaginylasparagin…
ucylglycyltyrosylhistidylleucylglutamy…
inylserylisoleucylleucyltryptophylthre…
nylisoleucylisoleucylhistidylaspartylt…
lanylglutaminylasparaginylleucylglutam…
rosylglutamylphenylalanylarginylvalylt…
eucylvalylglycylvalylglycyllysylalanyl…
ysteinyltyrosylvalylalanylarginylaspar…
lylglycylthreonylprolylglutamylprolyli…
sparaginylglutamylisoleucylthreonylleu…
lprolylvalyltyrosylaspartylglycylglycy…
cyltyrosylisoleucylvalylglutamyllysyla…
lycylarginyltryptophylmethionyllysylal…
ginylvalylisoleucylglutamylthreonylglu…
ylglycylleucylthreonylglutamylaspartyl…
nylalanylarginylvalylisoleucylalanylly…
nylisoleucylseryllysylprolylserylaspar…
ylthreonylalanyllysylaspartylglutamylv…
eucylserylmethionylaspartylprolyllysyl…
isoleucylvalylvalylasparaginylalanylgl…
inylleucylglutamylalanylaspartylvalylh…
lthreonylisoleucylglutamyltryptophylle…
mylisoleucylglutamylglutamylserylalany…
ysylasparaginylthreonylaspartylphenyla…
ylvalyllysylaspartylalanylisoleucylarg…
utaminyltyrosylisoleucylleucylarginyla…
cylseryllysylserylphenylalanylprolylva…
aspartylarginylprolylglycylprolylproly…
lvalylthreonylglycylvalylthreonylseryl…
reonyltryptophylserylprolylprolylleucy…
laspartylisoleucylserylhistidyltyrosyl…
mylthreonylserylarginylleucylalanyltry…
lglutamylvalylvalylthreonylasparaginyl…
eucylleucylglutamylglycylasparaginylgl…
ylisoleucylmethionylalanylvalylasparag…
utamylprolylleucylglutamylserylalanylp…
aginylprolylphenylalanylvalylleucylpro…
ylglutamylvalylthreonylasparaginylisol…
nylthreonylvalylcysteinyltryptophylasp…
spartylglycylglycylserylglutamylisoleu…
alylglutamyllysylarginylaspartylarginy…
hylisoleucyllysylcysteinylasparaginyll…
aspartylleucylarginylleucylarginylvaly…
ylaspartylhistidylglutamyltyrosylgluta…
nylglutamylasparaginylalanylalanylglyc…
lylalanylthreonylvalyltyrosyltyrosylly…
ylphenylalanyllysylprolylglycylprolylp…
dylisoleucylvalylaspartylthreonylthreo…
reonylleucylalanyltryptophylglycyllysy…
ylglycylserylglutamylisoleucylleucylgl…
cylcysteinyllysylalanylaspartylglutamy…
ylisoleucylvalylthreonylprolylglutamin…
hreonylarginylphenylalanylglutamylisol…
ylhistidylglutaminylglutamyltyrosyllys…
nylleucylasparaginyllysylvalylglycylle…
ylvalylprolylglycylthreonylvalyllysylp…
tamylalanylprolylglutamylleucylasparty…
rginyllysylglycylisoleucylvalylvalylar…
rginylisoleucylhistidylisoleucylprolyl…
lmethionylprolylglutamylisoleucylthreo…
utamylglycylglutamylphenylalanylthreon…
ucylglutamyllysylglycylvalylasparaginy…
ylisoleucylaspartylasparaginylcysteiny…
alanylglycyllysyltyrosylisoleucylleucy…
lserylglycylseryllysylserylalanylpheny…
leucylaspartylthreonylprolylglycylprol…
alanylvalyllysylglutamylvalylarginylly…
eucylvalyltryptophylglutamylprolylprol…
lycylalanyllysylvalyllysylasparaginylt…
ginylglutamylserylthreonylarginyllysyl…
serylseryllysylcysteinylseryllysylthre…
amylasparaginylleucylthreonylglutamylg…
henylalanylarginylvalylmethionylalanyl…
anylglycylvalylglycylvalylprolylvalylg…
alyllysylalanylalanylglutamylprolylpro…
lthreonylleucylthreonylaspartylvalylse…
ylleucylmethionyltryptophylglutamyllys…
cylglycylserylarginylvalylleucylglycyl…
lutaminylprolyllysylglycylthreonylglut…
lylalanylglutamylseryllysylvalylcystei…
nylglycylleucylserylserylglycylglutami…
lanylarginylvalyllysylalanyltyrosylasp…
ylaspartylprolylarginylvalylleucylglyc…
sylaspartylleucylthreonylisoleucylglut…
rolylphenylalanylasparaginylthreonylty…
glycylglutamylaspartylleucyllysylisole…
leucylglycylarginylprolylarginylprolyl…
valyllysylaspartylglycylglutamylprolyl…
ylarginylvalylasparaginylvalylglutamyl…
threonylvalylleucylhistidylisoleucylly…
partylaspartylphenylalanylglycyllysylt…
reonylasparaginylserylalanylglycylthre…
ylleucylserylvalylisoleucylvalylleucyl…
ylvalylglycylprolylvalylarginylphenyla…
ylaspartylphenylalanylvalylvalylisoleu…
lylalanyltyrosylthreonylglycylglycylcy…
raginyltyrosylisoleucylvalylglutamylly…
hreonylthreonylthreonyltryptophylhisti…
lvalylalanylarginylthreonylthreonyliso…
ucyllysylthreonylglycylthreonylglutamy…
ylisoleucylphenylalanylalanylglutamyla…
serylalanylprolylleucylaspartylserylly…
nyltyrosylprolylphenylalanyllysylgluta…
reonylprolylphenylalanylvalylthreonyls…
aminylmethionylleucylvalylglutaminyltr…
asparaginylaspartylglycylglycylthreony…
ylhistidylleucylglutamylglutaminyllysy…
ucylleucyltryptophylvalyllysylleucylas…
ylglutaminylaspartylthreonyllysylpheny…
eucylaspartylglutamylglycylleucylgluta…
valylserylalanylglutamylasparaginyliso…
ylprolylseryllysylvalylserylglutamylcy…
ylaspartylprolylcysteinylaspartylproly…
lanylisoleucylvalylisoleucylthreonylar…
eonylleucyllysyltryptophyllysyllysylpr…
ylseryllysylisoleucylthreonylglycyltyr…
laspartylleucylprolylaspartylglycylarg…
erylphenylalanylthreonylasparaginylval…
nylalanylthreonylvalylserylglycylleucy…
inyltyrosylglutamylphenylalanylarginyl…
nylalanylalanylglycylasparaginylphenyl…
tylserylserylglycylalanylisoleucylthre…
oleucylaspartylalanylprolylasparaginyl…
ltyrosyllysylaspartylvalylisoleucylval…
threonylphenylalanylvalylleucylglutamy…
yllysylprolylisoleucylprolylaspartylva…
lglycyllysylglutamylleucylglutamylglut…
ionylglutamylisoleucyllysylserylthreon…
hreonylleucylvalylvalyllysylaspartylcy…
rtylglycylglycylglutaminyltyrosylisole…
ylvalylglycylglycylthreonyllysylseryli…
llysylvalylleucylaspartylarginylprolyl…
ylleucyllysylvalylthreonylglycylvalylt…
tyrosylleucylalanyltryptophylasparagin…
tylglycylglycylalanylasparaginylisoleu…
leucylglutamyllysylarginylglutamylthre…
ylthreonylglutaminylvalylserylthreonyl…
asparaginyltyrosyllysylvalylthreonylly…
nylglutamyltyrosylisoleucylphenylalany…
paraginyllysyltyrosylglycylisoleucylgl…
ylglycylprolylvalylthreonylalanylcyste…
olylprolylglycylprolylprolylserylthreo…
oleucylthreonyllysylaspartylserylmethi…
nylarginylprolylvalylaspartylaspartylg…
lglutamylglycyltyrosylisoleucylleucylg…
tamylglycylvalylarginyltryptophylthreo…
sylthreonylleucylthreonylaspartylleucy…
lycylleucylthreonylglutamylglycylhisti…
arginylvalylalanylalanylglutamylaspara…
lutamylprolylserylglutamylprolylserylv…
lcysteinylaspartylalanylleucyltyrosylp…
sparaginylprolyllysylvalylthreonylaspa…
alylserylleucylalanyltryptophylserylly…
ycylglycylalanylprolylvalyllysylglycyl…
glutamylalanylalanylalanylaspartylglut…
inylthreonylprolylprolylthreonylglycyl…
ylphenylalanylthreonylvalylthreonyllys…
eonylglutamyltyrosylasparaginylphenyla…
lisoleucylasparaginylserylglutamylglyc…
reonylleucylprolylglycylserylvalylvaly…
leucylglutamylprolylprolylglutamylisol…
partylleucylarginyllysylvalylvalylvaly…
onylleucylarginylleucylphenylalanylval…
ylprolylglutamylprolylglutamylvalyllys…
amylglycylisoleucylleucylthreonylaspar…
glutamylvalylthreonylserylserylphenyla…
oleucylaspartylasparaginylvalylthreony…
ycylarginyltyrosylasparaginylleucylthr…
aginylserylglycylseryllysylthreonylala…
larginylvalylleucylaspartylserylprolyl…
ucylthreonylisoleucylarginylglutamylva…
onylleucylseryltryptophylglutamylproly…
lglycylalanyllysylisoleucylthreonylasp…
yllysylarginylglutamylthreonylthreonyl…
onylisoleucylthreonylasparaginylaspara…
threonylphenylalanylarginylisoleucylgl…
utamylglycylcysteinylseryltyrosyltyros…
nylserylasparaginylglutamyltyrosylglyc…
glutamylthreonylthreonylglutamylprolyl…
rolylleucylprolylprolylglycylarginylva…
threonylarginylasparaginylthreonylalan…
lutamyllysylprolylglutamylserylasparty…
eonylglycyltyrosylvalylvalylglutamylme…
lserylglutamyllysyltryptophylserylthre…
llysylthreonylleucylglutamylalanylthre…
nylalanylglycylglutamylglutamyltyrosyl…
alanylvalylasparaginylglutamyllysylgly…
lglutaminylleucylglycylvalylprolylvaly…
eucylglutamylisoleucyllysylprolylseryl…
ylhistidylthreonylphenylalanylasparagi…
lutaminylleucyllysylisoleucylaspartylv…
ginylprolylglutaminylalanylthreonylval…
aspartylglycylglutaminylthreonylleucyl…
lvalylasparaginylvalylserylserylseryll…
lserylisoleucyllysylglutamylalanylsery…
reonyltyrosylglutamylleucylcysteinylva…
lserylisoleucylthreonylvalylprolylisol…
lleucylaspartylarginylprolylglycylprol…
lisoleucylaspartylglutamylvalylserylcy…
ylisoleucylseryltryptophylasparaginylp…
lycylglycylcysteinylglutaminylisoleucy…
lylglutamyllysyllysylglutamylthreonylt…
hylhistidylisoleucylvalylserylglutamin…
erylisoleucyllysylisoleucylvalylarginy…
lutamyltyrosylglutaminylphenylalanylar…
paraginylarginyltyrosylglycyllysylsery…
lalanylvalylvalylalanylglutamyltyrosyl…
glycylprolylprolylglycylthreonylprolyl…
yllysylserylthreonylmethionylleucylval…
prolylvalylasparaginylaspartylglycylgl…
ltyrosylhistidylleucylglutamyltyrosyll…
cylleucyltryptophylseryllysylalanylasp…
ylalanylaspartylthreonylglutaminylvaly…
lglutamylglycylleucylmethionyltyrosylg…
anylglutamylasparaginylisoleucylalanyl…
seryllysylserylcysteinylglutamylprolyl…
lylcysteinylaspartylprolylprolylglycyl…
ylasparaginylisoleucylthreonylarginyll…
ophylseryllysylprolylhistidyltyrosylas…
cylthreonylglycyltyrosylisoleucylvalyl…
lprolylaspartylglycylarginyltryptophyl…
sylthreonylasparaginylisoleucylglutami…
nylglutamylvalylthreonylglutamylleucyl…
rginyltyrosylglutamylphenylalanylargin…
araginylalanylalanylaspartylserylvalyl…
ylthreonylglycylprolylisoleucylisoleuc…
utamylprolylprolylarginylvalylmethiony…
lanylarginylaspartylvalylisoleucylvaly…
lleucyllysylisoleucylasparaginylalanyl…
lprolylleucylprolylvalylisoleucylseryl…
isoleucylglutamylisoleucylglutamylglut…
tamylisoleucylisoleucylserylthreonylas…
ucylleucylthreonylvalyllysylaspartylcy…
tylthreonylglycylglutaminyltyrosylvaly…
ylvalylalanylglycylthreonylarginylsery…
yllysylvalylleucylaspartyllysylprolylg…
leucylglutamylisoleucylasparaginylglyc…
cysteinylserylleucylseryltryptophylgly…
spartylglycylglycylalanylaspartylisole…
rginyllysyllysylarginylglutamylthreony…
lthreonylisoleucylcysteinylglutamylgly…
lthreonylserylcysteinyllysylvalylthreo…
raginylglutamyltyrosylisoleucylphenyla…
lasparaginyllysyltyrosylglycylvalylgly…
lvalylalanylisoleucyllysylalanylleucyl…
alylprolylserylprolylprolylthreonylser…
rylvalylthreonyllysylglutamylserylmeth…
hylserylarginylprolylglutamylserylaspa…
cylserylglycyltyrosylisoleucylisoleucy…
lasparaginylserylleucylarginyltryptoph…
lysylprolylvalyltyrosylaspartylleucyla…
leucylarginylglutamylglycylcysteinylgl…
valyltyrosylalanylglutamylasparaginyla…
rolylserylglutamylthreonylserylprolyll…
aspartylprolylvalylphenylalanylleucylp…
lyllysylisoleucylvalylaspartylserylgly…
reonylisoleucylalanyltryptophylvalylly…
glycylglycylalanylprolylisoleucylthreo…
yltyrosyllysyllysylserylaspartylaspart…
reonylserylisoleucylglutaminylserylleu…
osylthreonylisoleucylserylglycylleucyl…
ltyrosylvalylphenylalanylarginylvalyll…
glycylalanylserylaspartylprolylserylas…
minylisoleucylalanyllysylglutamylargin…
cylphenylalanylaspartylisoleucylaspart…
lthreonylleucylisoleucylvalyllysylalan…
onylmethionylthreonylvalylprolylphenyl…
ylprolylasparaginylvalylleucyltryptoph…
spartylleucylarginylthreonylarginylala…
onylaspartylserylarginylthreonylseryll…
aginylalanylasparaginylarginylasparagi…
hreonylleucylthreonylisoleucylglutamin…
alanylserylleucylthreonylleucylvalylva…
prolylglycylprolylprolylthreonylaspara…
ylaspartylvalylthreonyllysylglutamylse…
aspartylvalylprolylglutamylasparaginyl…
yllysylasparaginyltyrosylhistidylisole…
nylseryllysyllysylalanyltryptophylvaly…
aginylcysteinylasparaginylarginylleucy…
raginylleucylglutaminylglutamylglycyla…
lanylarginylvalylserylglycylglutamylas…
valylglycylisoleucylprolylalanylglutam…
ysylisoleucylthreonylglutamyllysylprol…
cylglycylvalylthreonylserylisoleucylse…
ylthreonyltryptophylleucyllysylprolylg…
serylarginylisoleucylvalylhistidyltyro…
utamyllysylglycylglutaminyllysylaspara…
lanylvalylalanyllysylserylthreonylhist…
ucylarginylglutamylasparaginylserylglu…
larginylvalylphenylalanylalanylglutamy…
eucylserylaspartylprolylarginylglutamy…
lisoleucyllysylglutamylglutaminylleucy…
cylaspartylmethionyllysylasparaginylph…
ylvalyltyrosylvalylarginylalanylglycyl…
artylisoleucylprolylisoleucylserylglyc…
threonylleucylserylarginylaspartylglyc…
nylmethionylarginylphenylalanylasparag…
ylalanylglutamylasparaginylleucylthreo…
lutamylserylvalylthreonylalanylasparty…
isoleucylthreonylalanylalanylasparagin…
ysylalanylphenylalanylisoleucylasparag…
ylarginylprolylglycylprolylprolylthreo…
erylaspartylisoleucylthreonylglutamylg…
ltryptophylglutamylprolylprolyllysylty…
minylvalylthreonylasparaginyltyrosylis…
amylthreonylserylthreonylalanylvalyltr…
lanylthreonylvalylalanylarginylthreony…
nyllysylleucylthreonylthreonylglycylgl…
ylalanylarginylisoleucyllysylalanylglu…
glycylisoleucylserylaspartylhistidylis…
valylthreonylvalyllysylleucylprolyltyr…
lylprolylserylthreonylprolyltryptophyl…
ylarginylglutamylserylisoleucylthreony…
mylprolylvalylserylasparaginylglycylgl…
sylhistidylleucylglutamylmethionyllysy…
leucylleucyltryptophylglutaminyllysyla…
leucylarginylthreonylthreonylhistidylp…
ylisoleucylserylalanylglycylleucylisol…
inylvalyltyrosylalanylglutamylasparagi…
ylprolylserylhistidylprolylserylglutam…
spartylalanylcysteinylglutamylprolylpr…
soleucylthreonylaspartylisoleucylseryl…
ylseryltryptophylglutaminylglutaminylp…
ylglycylseryllysylisoleucylthreonylgly…
inylarginylaspartylleucylprolylasparty…
ylalanylserylphenylalanylthreonylaspar…
glutaminylphenylalanylthreonylisoleucy…
lasparaginylserylglutaminyltyrosylglut…
lanylalanylarginylasparaginylalanylval…
nylprolylserylglutamylvalylvalylglycyl…
leucylaspartylseryltyrosylglycylglycyl…
rolylleucylglutamyltyrosylthreonylglut…
anylglycylthreonylserylvalyllysylleucy…
lycyllysylprolylalanylprolylthreonylis…
ylaspartylaspartyllysylglutamylleucylg…
eucylvalylcysteinylvalylglutamylaspara…
alanylserylisoleucylleucylisoleucyllys…
ylasparaginylserylglycylcysteinyltyros…
sparaginylalanylmethionylalanylserylal…
inylvalylglutaminylisoleucylleucylaspa…
ycylglycylprolylisoleucylglutamylpheny…
anylglutamyllysylisoleucylthreonylleuc…
ylalanylaspartylaspartylglycylglycylal…
yrosylisoleucylvalylglutamyllysylargin…
valyltryptophylserylmethionylvalylsery…
amylcysteinylisoleucylisoleucylthreony…
eucyllysylglycylasparaginylglutamyltyr…
ylarginylalanylvalylasparaginyllysylty…
rolylleucylglutamylserylaspartylserylv…
ylphenylalanylvalylthreonylprolylglycy…
lutamylvalylthreonyllysylisoleucylthre…
hreonylvalylvalyltryptophylserylarginy…
lglycylserylaspartylisoleucylserylglyc…
lysylarginylaspartyllysyllysylserylleu…
lvalylleucyllysylglutamylthreonylisole…
lutaminyllysylvalylthreonylglycylleucy…
partyltyrosylglutaminyltyrosylarginylv…
alanylalanylglycylglutaminylglycylprol…
rylglutamylphenylalanyltyrosyllysylala…
artylprolylprolylglycylprolylprolylala…
anylaspartylserylthreonyllysylserylser…
tophylseryllysylprolylvalyltyrosylaspa…
eonylglycyltyrosylvalylvalylglutamylis…
mylglutamylglutamylglutamyltryptophylt…
sylglycylglutamylvalylarginylthreonylt…
ylasparaginylleucyllysylprolylglycylva…
lanylarginylvalylserylalanylvalylaspar…
ylglycylglutamylprolylisoleucylglutamy…
valylglutaminylalanyllysylaspartylisol…
amylisoleucylaspartylleucylaspartylval…
alylisoleucylalanyllysylalanylglycylgl…
eucylisoleucylprolylphenylalanyllysylg…
nylvalylthreonyltryptophylarginyllysyl…
cylglycylserylaspartylalanylarginyltyr…
ylthreonylaspartylserylserylserylleucy…
minylvalylthreonylarginylasparaginylas…
leucylleucylthreonylisoleucylglutamyla…
prolyllysylserylserylthreonylvalylsery…
nylprolylalanylalanylcysteinylglutamin…
stidylvalylserylarginylglycylthreonylv…
spartylprolylprolylleucylisoleucylaspa…
lisoleucylasparaginyltyrosylvalylisole…
nylthreonyllysylarginylthreonyltryptop…
lcysteinylserylserylthreonylserylpheny…
leucylserylglutamyllysylthreonylprolyl…
larginylvalylleucylalanylglutamylaspar…
cylglycylglutamylprolylcysteinylglutam…
yllysylalanylalanylglutamylvalylprolyl…
lleucylserylmethionyllysylaspartylsery…
leucylleucylseryltryptophylthreonyllys…
lglycylglycylserylvalylisoleucylthreon…
arginyllysylglycyllysylglycylglutamylg…
tidylalanylglycylisoleucylseryllysylth…
tamylvalylserylglutaminylleucyllysylgl…
tamylphenylalanylarginylvalylphenylala…
sylglycylleucylserylaspartylprolylvaly…
ucylthreonylvalyllysylglutamylleucylis…
mylvalylaspartylleucylserylaspartyliso…
alylthreonylvalylarginylisoleucylglycy…
ucylglutamylleucylprolyltyrosyllysylgl…
eucylseryltryptophylleucyllysylasparty…
mylserylglutamylphenylalanylvalylargin…
tamylasparaginyllysylisoleucylthreonyl…
lalanyllysyllysylglutamylhistidylglycy…
leucylleucylaspartylasparaginylalanylv…
valylprolylisoleucylthreonylvalylisole…
lseryllysylprolyllysylglycylprolylisol…
tamylisoleucyllysylalanylaspartylseryl…
aspartylvalylprolylglutamylaspartylasp…
soleucylthreonylcysteinyltyrosylseryli…
lthreonylserylglutaminylthreonylaspara…
ysteinylserylserylvalylalanylarginylth…
lprolylasparaginylleucylvalyllysylaspa…
phenylalanylarginylvalylarginylalanylg…
cylvalylserylglutaminylprolylleucylval…
alanyllysylhistidylglutaminylphenylala…
ylprolylglycyllysylprolylvalylisoleucy…
ylaspartylglycylmethionylserylleucylth…
lvalyltyrosylaspartylglycylglycylseryl…
anylhistidylvalylglutamyllysyllysylglu…
ylleucyltryptophylglutaminyllysylvalyl…
ucylserylglycylarginylglutamyltyrosyla…
ylglutamylglycylleucylaspartyltyrosylg…
rosylalanylglutamylasparaginylserylala…
laspartylprolylseryllysylphenylalanylt…
valylaspartylprolylprolylglycylthreony…
rtylvalylthreonylarginylglutamylthreon…
ophylasparaginylprolylprolylleucylargi…
oleucylvalylglycyltyrosylserylisoleucy…
ylasparaginylglutamylarginyltryptophyl…
nylalanylthreonylaspartylvalylserylglu…
onylvalylthreonylglycylleucylserylprol…
mylphenylalanylarginylisoleucylisoleuc…
ylglycylthreonylisoleucylserylprolylpr…
isoleucylisoleucylmethionylthreonylarg…
lprolylprolylisoleucylvalylglutamylphe…
lphenylalanylaspartylglycylleucylisole…
ylserylleucylarginylisoleucyllysylalan…
lprolylvalylprolylarginylvalylthreonyl…
glycylvalylglutamylisoleucylglutamylly…
onylglutamylisoleucylthreonylasparagin…
ylleucylphenylalanylvalylarginylaspart…
idylarginylglycylvalyltyrosylthreonylv…
lanylserylglycylserylalanyllysylalanyl…
ylglutaminylaspartylthreonylprolylglyc…
cylarginylphenylalanylthreonylasparagi…
ysylmethionylthreonylleucyltryptophylt…
asparaginylaspartylglycylcysteinylalan…
rosylisoleucylisoleucylglutamyllysylar…
ucylalanyltryptophylalanylleucylisoleu…
utamylalanylglutaminylseryltyrosylthre…
ucylasparaginylglycylasparaginylglutam…
nylvalylserylalanylvalylasparaginyllys…
nylprolylleucylaspartylserylaspartylpr…
ucylglutaminyltyrosylthreonylvalylprol…
ylprolylglutamylprolylserylasparaginyl…
erylisoleucylthreonylleucylthreonyltry…
erylaspartylglycylglycylserylglutamyli…
isoleucylleucylglutamylarginylarginylg…
yltryptophylvalyllysylvalylisoleucylse…
glutamylthreonylarginylphenylalanyllys…
glutamylglycylasparaginylglutamyltyros…
methionylalanylglutamylasparaginylalan…
ylserylglycylisoleucylserylarginylleuc…
tamylprolylvalylasparaginylprolylproly…
yllysylvalylthreonylaspartylthreonylse…
eucylglutamyltryptophylseryllysylproly…
cylmethionylglutamylisoleucylisoleucyl…
amylmethionylcysteinyllysylthreonylasp…
histidyllysylvalylasparaginylalanylglu…
nylarginyltyrosylthreonylvalylthreonyl…
lglutamylglutamyltyrosyllysylphenylala…
asparaginylglycylalanylglycyllysylglyc…
ylthreonylglycylthreonylisoleucyllysyl…
eonylalanylprolylglutamylleucylasparty…
phenylalanyllysylglutaminylthreonylhis…
lanylserylisoleucylarginylleucylphenyl…
nylglycylarginylprolylthreonylprolylth…
ylprolylaspartylserylasparaginylleucyl…
leucylhistidylthreonylthreonylaspartyl…
lthreonylvalylglutamylasparaginylcyste…
partylalanylglycyllysyltyrosylthreonyl…
nylasparaginylserylglycylseryllysylser…
onylvalyllysylvalylleucylaspartylthreo…
olylisoleucylthreonylphenylalanyllysyl…
erylalanylthreonylleucylmethionyltrypt…
ylaspartylglycylglycylalanylarginyliso…
alylglutamyllysylarginylglutamylalanyl…
lutaminylvalylisoleucylserylglutamylly…
ylisoleucylphenylalanyllysylvalylaspar…
lycylvalylprolyltyrosyltyrosylphenylal…
araginylglutamyltyrosylglycylvalylglyc…
ionylprolylglutamylprolylisoleucylvaly…
olylalanylprolylprolylarginylarginylle…
nylseryllysylserylserylalanylvalylleuc…
aspartylhistidylaspartylglycylglycylse…
rosylleucylleucylglutamylmethionylargi…
ylleucyltryptophylvalylglutamylalanylg…
lleucylthreonylphenylalanylthreonylval…
llysylthreonylglutamyltyrosylglutamylp…
ysylasparaginylaspartylalanylglycyltyr…
mylalanylphenylalanylserylserylvalylis…
glutaminylisoleucylglutamylprolylthreo…
ylisoleucylthreonylasparaginylglutamin…
ysylalanylglycylserylprolylphenylalany…
ylisoleucylserylglycylarginylprolylala…
yllysylleucylglutamylglutamylmethionyl…
spartylarginylvalylserylisoleucylthreo…
inylthreonylthreonylleucylthreonylvaly…
glycylaspartylserylglycylarginyltyrosy…
utamylasparaginylthreonylalanylglycylv…
alylthreonylvalylvalylvalylisoleucylgl…
hreonylglycylprolylisoleucylglutamylva…
ylserylcysteinylvalylleucylseryltrypto…
ylglycylglycylglycylthreonylglutamylis…
oleucylvalylglutamyllysylarginylglutam…
tryptophylglutaminylleucylvalylasparag…
onylglutaminylisoleucyllysylvalylthreo…
ylmethionylglutamyltyrosylserylphenyla…
asparaginylarginylphenylalanylglycylva…
rylalanylprolylisoleucylisoleucylalany…
valylprolylprolylserylalanylprolylthre…
ylhistidylvalylserylalanylasparaginyla…
tryptophylglutamylglutamylprolyltyrosy…
ysylisoleucylisoleucylglycyltyrosyltry…
mylarginylasparaginylthreonylisoleucyl…
sparaginyllysylvalylprolylcysteinylleu…
syllysylvalylthreonylglycylleucylvalyl…
glutaminylphenylalanylarginylthreonylt…
alanylglycylvalylseryllysylalanylseryl…
leucylmethionylalanylglutaminylasparag…
glycylarginylprolylglutamylvalylthreon…
threonylvalylserylleucylisoleucyltrypt…
aspartylglycylglycylseryllysylvalylval…
utamylarginyllysylprolylvalylserylglut…
ltryptophylleucyllysylcysteinylasparag…
rylaspartylasparaginylphenylalanylphen…
leucylserylglutamylglycylaspartylthreo…
ylvalylleucylalanyllysylasparaginylala…
ysylglycylserylglutamylserylthreonylgl…
inylaspartylglutamyltyrosylalanylproly…
artylalanylarginylleucylhistidylglycyl…
larginylalanylglycylserylaspartylleucy…
ylglycylglycyllysylprolylglutamylproly…
hreonyllysylglycylaspartyllysylglutamy…
myllysylvalylserylleucylglutaminyltyro…
threonylalanylvalylisoleucyllysylpheny…
laspartylserylglycyllysyltyrosylthreon…
ylalanylserylglycylthreonyllysylalanyl…
alylleucylaspartylserylprolylglycylpro…
ylvalylserylarginylvalylthreonylglutam…
eucylalanyltryptophylserylleucylprolyl…
cylalanylglutamylisoleucylthreonylhist…
ginylarginylglutamylthreonylserylargin…
soleucylvalylglutamylglycylglutamylcys…
sylvalylvalylthreonylarginylleucylisol…
tamyltyrosylisoleucylphenylalanylargin…
llysyltyrosylglycylprolylglycylvalylpr…
lisoleucylvalylalanylarginylasparaginy…
prolylserylprolylprolylglycylisoleucyl…
reonylglycyllysylglutamylhistidylisole…
ptophylthreonyllysylprolylglutamylsery…
tamylisoleucylserylasparaginyltyrosyll…
myllysylglutamylserylleucylarginyltryp…
yllysylaspartyltyrosylvalylvalyltyrosy…
valylthreonylserylleucylmethionylgluta…
utaminylphenylalanylarginylvalylthreon…
lglycylasparaginylserylglutamylprolyls…
phenylalanylisoleucylserylcysteinylarg…
nylprolylglycylprolylprolylserylalanyl…
onylthreonyllysylhistidylserylisoleucy…
llysylprolylmethionyltyrosylaspartylgl…
valylglycyltyrosylvalylleucylglutamylm…
rtylthreonylaspartylglutaminyltryptoph…
ylasparaginylalanylthreonylisoleucylar…
nylalanylthreonylvalylprolylaspartylle…
ysyltyrosylserylphenylalanylarginylval…
lysylglycylmethionylserylglutamyltyros…
glutamylisoleucylglutamylprolylvalylgl…
ucylprolylaspartylleucylglutamylleucyl…
sylthreonylvalylthreonylisoleucylargin…
nylleucylmethionylvalylserylvalylseryl…
lisoleucylthreonyltryptophylseryllysyl…
ucylalanylserylarginylalanylisoleucyli…
tamylseryltyrosylserylleucylleucylisol…
inylarginyltyrosylaspartylalanylglycyl…
ylalanylglutamylasparaginylglutaminyls…
onylvalylleucylvalyllysylvalyltyrosyla…
steinylprolylserylvalyllysylvalyllysyl…
rylvalylthreonylisoleucylthreonyltrypt…
lisoleucylaspartylglycylglycylalanylpr…
tyrosylisoleucylvalylglutamyllysylargi…
inylalanylphenylalanyllysylthreonylval…
yllysylthreonylleucyltyrosylarginyliso…
lglycylthreonylmethionylhistidyltyrosy…
ylglutamylasparaginylisoleucyltyrosylg…
ysteinylglutamylthreonylserylaspartyla…
alylprolylleucylvalylprolylalanyllysyl…
ylthreonyllysylserylthreonylvalylthreo…
sylprolylleucyltyrosylaspartylglycylgl…
ltyrosylvalylleucylglutamylalanylcyste…
ylarginyltryptophylmethionyllysylvalyl…
nylvalylleucylglutamylhistidylthreonyl…
glutamylglycylglutamylglutaminyltyrosy…
arginylalanylglutaminylasparaginylglut…
olylarginylglutamylthreonylvalylthreon…
laspartylleucylarginylvalylleucylproly…
ylthreonylmethionylprolylglutaminyllys…
lylalanylglycylarginylprolylvalylgluta…
cylalanylglycylarginylprolylprolylprol…
alanylphenylalanylalanylglycylseryllys…
larginylvalylthreonylvalylglutamylthre…
llysylleucylthreonylisoleucylarginylgl…
nylaspartylthreonylglycylglutamyltyros…
asparaginylvalylthreonylglycylthreonyl…
cyllysylvalylisoleucylisoleucylleucyla…
lthreonylglycylprolylisoleucyllysyliso…
rtylalanylthreonylserylisoleucylthreon…
rolylprolylglutamylleucylaspartylglycy…
ltyrosylvalylvalylglutamylglutaminylar…
rolylglycyltryptophylleucylprolylvalyl…
nylserylthreonylphenylalanyllysylpheny…
lglutamylglycylasparaginylglutamyltyro…
nylalanylthreonylasparaginylarginylphe…
tyrosylleucylglutaminylserylglutamylva…
lserylserylisoleucylarginylisoleucylpr…
nylleucylglutaminylisoleucylphenylalan…
glycylmethionylthreonylleucylthreonylt…
laspartylaspartylglycylglycylserylglut…
leucylvalylglutamylarginyllysylglutamy…
ryptophylvalylarginylvalylasparaginyll…
ylthreonylarginyltyrosylarginylserylth…
lycylleucylglutamyltyrosylglutamylhist…
ucylasparaginylalanylarginylglycylsery…
lseryllysylprolylisoleucylvalylalanylm…
ylprolylprolylglycyllysylprolylglutami…
eonylaspartylthreonylthreonylarginylth…
yptophylserylvalylprolylglutamylaspart…
ylthreonylglycyltyrosylleucylisoleucyl…
ylaspartylglutaminylhistidylglutamyltr…
aginylthreonylthreonylprolylthreonylly…
hreonylleucylthreonylhistidylleucylpro…
rosylarginylphenylalanylarginylvalylle…
lglycylglycylprolylglycylglutamylproly…
eonylvalyllysylvalylthreonylglutamylme…
spartyltyrosylglutamylleucylaspartylgl…
mylglycylisoleucylphenylalanylvalylarg…
eucylarginylleucylthreonylisoleucylpro…
henylalanylprolylisoleucylcysteinyllys…
ycylglutaminylaspartylisoleucylserylly…
lanylthreonylserylglutamylthreonylhist…
eucyllysylglutamylalanylaspartylarginy…
yrosylaspartylleucylvalylleucylglutamy…
yllysylalanylvalyltyrosylisoleucyllysy…
rylprolylasparaginylserylprolylglutamy…
spartylaspartylisoleucylglutaminylvaly…
tryptophylarginylprolylprolylalanylasp…
rtylisoleucylleucylglycyltyrosylisoleu…
amylvalylprolyllysylalanylalanyltrypto…
lserylarginylvalylarginylglycylthreony…
ucyllysylglutamylasparaginylvalylgluta…
ylvalylserylalanylglutamylasparaginylg…
lseryllysylprolylleucyllysylserylgluta…
llysylthreonylprolylleucylasparaginylp…
lasparaginylprolylprolylglutamylvalyll…
lserylvalylserylleucylseryltryptophyls…
tylglycylglycylserylarginylvalylthreon…
amylarginyllysylglutamylthreonylserylt…
ylhistidylasparaginyllysylthreonylglut…
onylmethionyltyrosylthreonylvalylthreo…
lanylglutamyltyrosylglutaminylphenylal…
glutaminylasparaginylaspartylvalylglyc…
rolylalanylserylglutamylprolylvalylval…
lalanylaspartyllysylprolylserylglutami…
ylisoleucylleucylserylisoleucylserylly…
glutaminyltryptophylglutamyllysylproly…
cyllysylglutamylisoleucylleucylglycylt…
larginylglutaminylserylglycylaspartyls…
asparaginyllysylglutamylarginylisoleuc…
lalanylthreonylisoleucylglycylglycylle…
tamyltyrosylglutamylphenylalanylarginy…
araginylglutamylthreonylglycylleucylse…
nylalanylmethionylserylisoleucyllysylt…
ylglutamylalanylprolylglycylisoleucyla…
partylvalylthreonylthreonyllysylleucyl…
lleucylserylcysteinylglutaminylisoleuc…
lylaspartylisoleucyllysyltryptophyltyr…
lutamylleucylisoleucylglutaminylseryla…
ylserylaspartylglycylarginylthreonylhi…
thionylthreonylglutamylglutamylglutami…
lyltyrosylthreonylcysteinylisoleucylal…
lglycylglutamylvalylglutamylthreonylse…
aminylalanylthreonylprolylglutaminylph…
ylprolylleucyllysylglutamyllysyltyrosy…
lthreonylleucylarginylleucylhistidylva…
rginylprolylvalylprolylalanylmethionyl…
dylglycylglutaminyllysylleucylleucylgl…
araginylisoleucylthreonylisoleucylglut…
idyltyrosylthreonylhistidylleucylvalyl…
minylarginyllysylthreonylhistidylalany…
inylleucylserylasparaginylvalylphenyla…
nylisoleucylleucylaspartylvalylglutamy…
olylaspartyllysylprolylthreonylglycylp…
lalanylleucylleucyllysylasparaginylser…
yllysylprolylprolylalanylaspartylaspar…
ucylthreonylasparaginyltyrosylvalylval…
nyllysylglutamylglycylalanylglutamyltr…
erylalanylisoleucylserylvalylthreonylt…
ylasparaginylleucylthreonylglutamylasp…
henylalanylarginylvalylserylalanylglut…
ylglycylisoleucylserylaspartylprolylle…
ylisoleucylisoleucyllysylserylprolylph…
alanylprolylglycyllysylprolylthreonyli…
lysylaspartylserylcysteinylvalylvalyla…
nylserylaspartylglycylglycylalanyllysy…
tyrosylleucylglutamyllysylarginylgluta…
ysyltryptophylisoleucylserylvalylthreo…
larginylglutamylthreonylvalylphenylala…
isoleucylglutamylglycylleucylglutamylt…
lyllysylcysteinylglutamylasparaginylle…
yltryptophylserylglutamylisoleucylsery…
lyllysylserylaspartylvalylprolylisoleu…
enylalanyllysylglutamylglutamylleucyla…
alylarginyltyrosylglutaminylserylaspar…
einyllysylvalylthreonylglycylhistidylp…
tryptophyltyrosylarginylglutaminylglyc…
anylaspartylglycylleucyllysyltyrosylar…
nylalanyllysylglycylglycyltyrosylhisti…
ylalanylserylvalylthreonylaspartylaspa…
sylglutaminylvalylarginylalanylthreony…
erylvalylserylglycylthreonylalanylsery…
olylalanyllysylisoleucylhistidylleucyl…
ycylmethionylglycylalanylvalylhistidyl…
lylvalylserylisoleucyllysylisoleucylpr…
lylaspartylprolylvalylisoleucylthreony…
taminylaspartylleucylisoleucylaspartyl…
ltyrosylglutaminylvalylisoleucylvalylt…
onylserylleucylvalylphenylalanylprolyl…
yllysylaspartylalanylglycylphenylalany…
sylasparaginylarginylphenylalanylglycy…
reonylvalylglutamylleucylaspartylvalyl…
olylprolylarginylglycylvalyllysylvalyl…
rtylserylvalylasparaginylleucylthreony…
anylserylaspartylglycylglycylseryllysy…
lisoleucylvalylglutamyllysylcysteinyla…
arginyltryptophylleucylarginylvalylgly…
hreonylarginyltyrosylthreonylvalylisol…
lycyllysylthreonylseryltyrosylglutamin…
alanylglutamylasparaginyllysylphenylal…
ylglutamylprolylserylglutamylprolylthr…
aspartyllysylthreonylarginylalanylmeth…
amylglutamylvalylaspartylglutamylthreo…
ylthreonyllysylalanylserylhistidylsery…
rosylglutamyllysyltyrosylmethionylisol…
ycylarginylglycylglutamylphenylalanylg…
ysteinylvalylglutamylthreonylserylsery…
alanyllysylphenylalanylvalyllysylvalyl…
ylvalylleucylvalyllysyllysylglutamylis…
nylisoleucylalanylarginylhistidylargin…
lleucylhistidylglutamylserylphenylalan…
tamylleucylvalylmethionylisoleucylphen…
ylserylglycylleucylaspartylisoleucylph…
sparaginylthreonylserylalanylphenylala…
larginylglutamylisoleucylvalylseryltyr…
teinylglutamylalanylleucylglutaminylph…
ylasparaginylisoleucylglycylhistidylph…
rolylglutamylasparaginylisoleucylisole…
larginylserylserylthreonylisoleucyllys…
lanylglycylglutaminylalanylarginylglut…
ylasparaginylphenylalanylarginylleucyl…
lylglutamyltyrosyltyrosylalanylprolylg…
dylaspartylvalylvalylserylthreonylalan…
ylserylleucylglycylthreonylleucylvalyl…
isoleucylasparaginylprolylphenylalanyl…
inylglutaminylglutaminylisoleucylisole…
hionylasparaginylalanylglutamyltyrosyl…
lglutamylalanylphenylalanyllysylglutam…
anylmethionylaspartylphenylalanylvalyl…
ylglutamylarginyllysylserylarginylmeth…
nylleucylglutaminylhistidylprolyltrypt…
eucylglutamylarginylvalylserylthreonyl…
eucyllysylhistidylarginylarginyltyrosy…
ucyllysyllysylaspartylleucylasparaginy…
ylarginylisoleucylserylcysteinylglycyl…
utaminyllysylglycylvalylserylvalylalan…
oleucylglutamylisoleucylglycylprolylva…
thionylhistidylalanylvalylglycylglutam…
lysyltyrosylvalylcysteinyllysylisoleuc…
lglutaminylserylthreonylglutaminylvaly…
nylglycylvalylarginylglutaminylleucylg…
ltyrosylglutamylisoleucylthreonyltyros…
isoleucylleucyltyrosylvalyllysylaspart…
tylaspartylglycylthreonyltyrosylarginy…
laspartyltyrosylglycylglutamylaspartyl…
ylphenylalanylvalyllysylglycylvalylarg…
osyltyrosylcysteinylarginylarginylthre…
ylarginylarginylthreonylaspartylthreon…
mylarginylprolylprolylglutamylphenylal…
ylasparaginyllysylthreonylalanyltyrosy…
larginylphenylalanylglycylvalylthreony…
ylglutamylprolylhistidylvalylthreonylt…
taminyllysylisoleucyllysylprolylglycyl…
yltyrosylthreonylphenylalanylglutamyls…
lglutaminylleucylthreonylisoleucylaspa…
partylaspartylaspartylalanylglutamylty…
lasparaginyllysyltyrosylglycylglutamyl…
sylleucylthreonylvalylthreonylleucylhi…
artylserylthreonylleucylarginylprolylm…
cylleucylalanylasparaginylalanylglutam…
glutaminylserylvalylcysteinylphenylala…
ylglycylisoleucylprolylprolylprolylthr…
ysylaspartylglycylglutaminylprolylleuc…
lisoleucylglutamylisoleucylisoleucylhi…
yrosyltyrosylalanylleucylhistidylisole…
olylglutamylaspartylthreonylglycyltyro…
lthreonylasparaginylthreonylalanylglyc…
inylalanylhistidylleucylglutaminylvaly…
llysyllysylglutaminylglutamylphenylala…
istidylglutamylarginylhistidylvalylglu…
rtyllysylthreonylleucylarginylmethiony…
glycylthreonylglutamylserylvalylprolyl…
lysylglutamylalanylleucylarginylglutam…
ylprolylalanylvalylserylthreonyllysylt…
ylalanylarginylleucylglutamylisoleucyl…
lutamylarginyllysylleucylarginylmethio…
glutamylprolylarginyllysyltyrosyllysyl…
glutamylglutamylaspartylglutaminylargi…
anylvalylprolylmethionylserylaspartylm…
lysylisoleucylarginylaspartylglutaminy…
yllysylleucylaspartylarginylvalylvalyl…
ginylisoleucylarginylleucylserylarginy…
alanyltyrosylvalylmethionylprolylleucy…
rtylglutaminyltyrosylarginylprolyllysy…
sylleucylserylglutaminylaspartylaspart…
ylprolylalanylarginylarginylarginylthr…
ylaspartylphenylalanyltyrosyltyrosylar…
ylleucylglycylaspartylisoleucylserylas…
eucylprolylisoleucylaspartylaspartylty…
nylthreonylglutamylglutamylglutamylarg…
amylglutamylleucylglutamylleucylglycyl…
rolylserylarginylserylprolylprolylhist…
serylleucylarginyltyrosylserylserylpro…
ylvalylglutamylglutamylthreonylarginyl…
tyrosylserylthreonyltyrosylhistidyliso…
amylalanylserylthreonylseryltyrosylala…
inylhistidylalanylglutaminylalanylalan…
ylglutaminylarginylglutaminylarginylis…
ylglutamylaspartylglutamylglutamylleuc…
hreonylthreonylglutaminylhistidylleucy…
amylleucylaspartylphenylalanylmethiony…
ylarginyllysyllysylserylarginylarginyl…
nylglutamylisoleucylthreonylglutamylis…
sylglutamylisoleucylseryllysylhistidyl…
lserylserylserylalanylserylarginylleuc…
lserylleucylserylprolylthreonyltyrosyl…
inylprolylvalylserylglutamylleucylisol…
minylprolylalanylglutamylglutamyltyros…
lutamylarginylarginylserylprolylthreon…
nylprolylarginylserylprolylserylprolyl…
leucylserylarginylphenylalanylglutamyl…
ylaspartylisoleucylphenylalanylserylar…
ysylalanylalanylleucyllysylthreonylglu…
ginyllysyltyrosylglutamylvalylleucylse…
alanylthreonylleucylaspartylhistidylal…
eucylarginylmethionylarginylserylhisti…
lglutaminylasparaginylthreonylarginylp…
ylvalylglutaminylseryllysylprolylthreo…
yltyrosylhistidylasparaginylglycylvaly…
rylseryllysylisoleucylhistidyltyrosylt…
ylvalylleucylthreonylleucylglutamyliso…
ylthreonylaspartylaspartylserylglycylt…
teinylthreonylasparaginyltyrosyllysylg…
osylalanylthreonylleucylaspartylvalylt…
hreonylthreonyltyrosylalanylserylgluta…
glutamylvalylprolylarginylserylvalylph…
nylarginylthreonylglutamylalanyltyrosy…
lysyllysylthreonylserylglutamylmethion…
larginylglutamylvalyllysylserylglutami…
larginylglutamylserylleucylserylserylt…
rylalanylglutamylmethionyllysylserylal…
ylserylleucylglutamylglutamyllysylsery…
cyllysylthreonylthreonylleucylalanylal…
ysylprolylarginylserylmethionylthreony…
serylalanylarginylphenylalanylserylcys…
lglutamylprolylvalylprolylthreonylvaly…
ylglycylglutaminylvalylleucylserylthre…
minylvalylthreonylthreonylthreonyllysy…
nylglutamylisoleucylserylserylvalylglu…
lycylasparaginyltyrosylserylvalylvalyl…
ylglycyllysylglutaminylglutamylalanylg…
reonylisoleucylglutaminyllysylalanylar…
ylvalylthreonylserylprolylprolylarginy…
larginylvalyllysylserylprolylglutamyla…
nylvalyllysylserylprolylglutamylprolyl…
serylprolylthreonylglutamylthreonyllys…
yllysylvalylglutaminylhistidylleucylpr…
ylisoleucylthreonylglutaminylphenylala…
eryllysylglutamylisoleucylalanyllysyll…
tamylserylserylvalylleucylarginylalany…
yltyrosyllysylaspartylglycyllysyllysyl…
lhistidylphenylalanylglutaminylphenyla…
rtylglycylthreonyltyrosylglutamylleucy…
ylleucylthreonylglutamylserylaspartylg…
cysteinylglutamylisoleucylserylglycylg…
ylthreonylasparaginylleucylglutaminylp…
lalanylphenylalanyllysylserylisoleucyl…
lisoleucylserylglutamylthreonyllysylly…
onylthreonylglutamylserylthreonylvalyl…
lprolyllysylalanylprolylglutamylprolyl…
isoleucylvalylthreonylglycylleucylglut…
serylserylaspartylserylvalylalanyllysy…
threonylglycylglutamylprolylarginylpro…
lthreonyllysylaspartylglycyllysylalany…
lycyllysyltyrosyllysylleucylserylgluta…
lanylphenylalanylleucylglutamylisoleuc…
onylserylaspartylserylglycylleucyltyro…
sylasparaginylserylalanylglycylserylva…
cylthreonylisoleucyllysylalanylisoleuc…
ylglutaminyllysylvalylserylthreonylglu…
oleucylthreonylprolylglutaminyllysylly…
ylglutamylisoleucylserylglutaminyllysy…
utamylisoleucyllysylmethionylserylglut…
myllysylleucylalanylleucyllysylglutamy…
lisoleucylserylglutamylglutamylvalylly…
rylleucylglutamyllysylserylisoleucylva…
lthreonyllysylthreonylserylglutaminyla…
nylthreonylhistidylalanylglutamylisole…
eonylglutaminylmethionylserylisoleucyl…
arginylleucylvalylleucyllysylalanylasp…
threonylaspartylvalyllysyltryptophylva…
amylleucylthreonylasparaginylserylglut…
ycylvalylserylglycylserylaspartylgluta…
llysylglutaminylalanylserylhistidylarg…
leucylthreonylcysteinylisoleucylseryll…
eucylvalyllysylcysteinylglutaminyltyro…
llysylglutamylleucylserylaspartylalany…
erylglutaminylprolylarginylserylglutam…
glutamylglycylglutaminylasparaginylval…
ylglutamylisoleucylserylglycylglutamyl…
lutamyltryptophylphenylalanyllysylaspa…
ucylserylisoleucylserylserylasparaginy…
ylarginylasparaginylvalyltyrosylseryll…
ginylalanylserylvalylserylaspartylsery…
llysylalanyllysylasparaginylphenylalan…
erylalanylthreonylalanylserylleucylmet…
lutamylglutamylprolylserylarginylgluta…
erylglycylaspartylthreonylserylleucylg…
ylserylglutaminylserylvalylglutaminylm…
inylglutamylalanylserylphenylalanylser…
erylalanylserylserylmethionylthreonylg…
anylserylmethionylserylalanylglutaminy…
lutaminylglutamylserylphenylalanylvaly…
rylphenylalanylmethionylglycylisoleucy…
lutaminylleucylglutamylserylserylthreo…
anylglycylisoleucylarginylglycylisoleu…
ylalanylleucylprolylserylaspartylisole…
lycyllysylvalylleucylthreonylvalylalan…
ylglycylglutamylprolylthreonylprolylgl…
ysteinylglycylglycylarginyllysylisoleu…
lutaminylglycylarginylphenylalanylhist…
eonylaspartylaspartylleucylthreonylthr…
nylaspartylvalylglutaminyllysylglutami…
lthreonylleucylserylleucylglycylaspara…
laspartylserylalanylthreonylvalylaspar…
inylserylisoleucine






Full chemical name of titin 

Methionylthreonylthreonylglutaminylala…
ylglutaminylprolylleucylglutaminylsery…
lserylthreonylalanylthreonylphenylalan…
rylglycylphenylalanylprolylvalylprolyl…
lanylarginylaspartylglycylglutaminylva…
nylleucylprolylglycylvalylglutaminylis…
ylglycylarginylalanyllysylleucylthreon…
llysylalanylasparaginylserylglycylargi…
eonylasparaginylglycylserylglycylgluta…
nylglutamylleucylleucylvalyllysylalany…
asparaginylphenylalanylvalylglutaminyl…
ylthreonylvalylarginylglutaminylglycyl…
utaminylvalylarginylvalylthreonylglycy…
lylvalyllysylphenylalanyltyrosylarginy…
cylglutaminylserylserylleucylaspartylp…
glutaminylglutamylglycylaspartylleucyl…
anylglutamylalanyltyrosylprolylglutamy…
serylvalylasparaginylalanylthreonylasp…
ylthreonylserylthreonylalanylglutamyll…
tamylglutamylglutamylvalylprolylalanyl…
eucylvalylserylthreonylalanylglutaminy…
glutaminylthreonylarginylisoleucylglut…
ylhistidylphenylalanylaspartylalanylar…
lylglutamylmethionylvalylisoleucylaspa…
nylglutaminylleucylprolylhistidyllysyl…
lprolylprolyllysylprolyllysylserylargi…
erylisoleucylalanylalanyllysylalanylgl…
ylglutaminylserylprolylserylprolylisol…
lprolylvalylarginylhistidylvalylarginy…
lylvalylarginylserylvalylserylprolylal…
onylserylprolylisoleucylarginylserylva…
thionylarginyllysylthreonylglutaminyla…
ylglycylprolylglutamylvalylprolylproly…
tamylglycyltyrosylvalylalanylserylsery…
ylarginylglutamylthreonylthreonylleucy…
minylisoleucylarginylthreonylglutamylg…
cylarginyltyrosylglycylvalylglutaminyl…
eucylserylglycylalanylalanylglycylalan…
serylalanylseryltyrosylalanylalanylglu…
lalanyllysylglutamylvalyllysylglutamin…
lanylalanylvalylalanylthreonylvalylval…
lalanylarginylvalylarginylglutamylprol…
tamylglutaminylthreonylalanylglutaminy…
eonylalanylvalylhistidylisoleucylgluta…
glutaminylvalylarginyllysylglutamylala…
threonyllysylvalylvalylvalylalanylalan…
lutaminylglutamylleucyllysylserylargin…
leucylthreonylthreonyllysylglutaminylg…
alylthreonylhistidylglutamylglutaminyl…
ylglutamyllysylthreonylphenylalanylval…
ylalanylalanyllysylalanyllysylglutamyl…
oleucylserylglutamylglutamylisoleucylt…
taminylvalylthreonylglutaminylglutamyl…
ylthreonylarginyllysylthreonylvalylval…
nylthreonylprolyllysylvalyllysylglutam…
larginylglycylarginylglutamylglycyliso…
lutamylglutaminylvalylglutaminylisoleu…
ethionylarginyllysylglutamylalanylglut…
hreonylisoleucylalanylvalylalanylthreo…
utaminylglutamylthreonylisoleucylleucy…
onylmethionylalanylthreonylarginylglut…
utaminylvalylthreonylhistidylglycyllys…
lalanylglutamylalanylvalylalanylthreon…
ylglutaminylalanylarginylvalylarginylg…
lycylhistidylleucylglutamylglutamylser…
threonylthreonylleucylglutamyltyrosylg…
leucylserylalanylalanyllysylvalylalany…
nylprolylalanylserylglutamylprolylhist…
llysylprolylarginylvalylisoleucylgluta…
nylhistidylisoleucyllysylthreonylthreo…
hionylhistidylisoleucylserylserylgluta…
eonylaspartylleucylthreonylthreonylglu…
laspartyllysylarginylprolylarginylthre…
alanylthreonylvalylseryllysylisoleucyl…
ylhistidylglycyltyrosylglutamylalanyls…
lisoleucylalanylthreonylleucylglutamin…
eonylserylserylalanylglutaminyllysylis…
alanylprolylthreonylvalyllysylprolylse…
nylalanylglutamylprolylthreonylprolyll…
olylphenylalanylalanylaspartylthreonyl…
erylglutamylalanylglycylvalylglutamylv…
lylserylisoleucylthreonylglycylthreony…
ylarginylphenylalanylglutamylvalylleuc…
yllysylvalylthreonylglutamylthreonylal…
alylglutamylisoleucylprolylvalylthreon…
rylglycylleucyllysylasparaginylvalylth…
lutamylserylvalylthreonylleucylglutamy…
cyltyrosylprolylserylprolylthreonylval…
lutamylaspartyltyrosylglutaminylisoleu…
tylphenylalanylglutaminylisoleucylthre…
ylisoleucylalanylarginylleucylmethiony…
ylalanylalanylglutamylaspartylserylgly…
inylserylalanylvalylasparaginylglutamy…
onylserylcysteinyltyrosylleucylalanylv…
tamylphenylalanylglutamyllysylglutamyl…
glutamyllysylphenylalanylthreonylthreo…
ylalanylvalylglutamylserylarginylaspar…
tylthreonylserylleucylthreonylglutamyl…
lglycylglutamylprolylalanylalanylproly…
yllysylprolylvalylvalylglutaminyllysyl…
lvalylvalylphenylalanylglycylcysteinyl…
nylprolyllysylprolylhistidylvalyltyros…
lylprolylleucylthreonylthreonylglycylt…
tyrosylasparaginyllysylglutaminylthreo…
ylvalylisoleucylserylmethionylthreonyl…
lanylglycylglutamyltyrosylthreonylisol…
sylhistidylglycylglutamylthreonylseryl…
lutamylglutamylalanylaspartyltyrosylgl…
ylglutaminylglutaminylglutamylmethiony…
taminylvalylthreonylalanylphenylalanyl…
ylvalylglycylglutamylthreonylalanylpro…
rylglutamyltyrosylglutamyllysylglutamy…
inylalanylleucylisoleucylarginyllysyll…
eonylvalylvalylvalylarginylthreonyltyr…
glutamylphenylalanylhistidylisoleucyls…
ylarginylleucylisoleucyllysylglutamyli…
ucylisoleucyllysylthreonylthreonylleuc…
mylglutamylaspartylglycylglutamylgluta…
lisoleucylserylglutamylserylglutamylal…
lanylaspartylleucylarginylisoleucyllys…
lleucylglutamylglycylmethionylglycylva…
einyllysylmethionylserylglycyltyrosylp…
yltryptophyltyrosyllysylaspartylglycyl…
lycylglutamylarginyltyrosylglutaminylm…
lutaminylaspartylglycylarginylalanylse…
lvalylleucylprolylglutamylaspartylglut…
lanylphenylalanylalanylserylasparaginy…
nylisoleucylcysteinylserylglycyllysyll…
ylalanylprolylleucylglycylalanylprolyl…
nylleucylglutamylprolylvalylserylargin…
rolylarginylserylvalylserylarginylsery…
ylprolylalanylarginylmethionylserylpro…
lalanylarginylmethionylserylprolylalan…
arginylarginylleucylglutamylglutamylth…
ylleucylglutamylarginylleucyltyrosylly…
yllysylprolylvalylserylphenylalanyllys…
ylasparaginylcysteinylarginylphenylala…
cylarginylprolylmethionylprolylglutamy…
ylalanylhistidylaspartylglycylglutamin…
ylaspartyltyrosylthreonylhistidyllysyl…
artylglycylthreonylglutaminylserylleuc…
ylthreonylprolylserylaspartylserylglyc…
lylalanylglutaminylasparaginylarginyla…
ylserylvalylisoleucylleucylthreonylval…
ylglutaminylvalyllysylprolylmethionylp…
lysylasparaginylvalylasparaginylisoleu…
eucylglutamylmethionyllysylvalylarginy…
lylasparaginylprolylaspartylisoleucylv…
lserylaspartylisoleucylisoleucylvalylp…
lisoleucylarginylisoleucylglutamylglyc…
alanylleucyllysylisoleucylaspartylsery…
ylserylalanyltryptophyltyrosylthreonyl…
ginyllysylalanylglycylarginylaspartylt…
lvalylasparaginylvalylglutamylvalylglu…
ylglutamylprolylglutamylarginyllysylle…
glycylthreonyltyrosylarginylalanyllysy…
lglutamylleucylglutamylprolylleucylhis…
aminylglutamylglutaminyltryptophylglut…
osylaspartyllysylglutamyllysylglutamin…
phenylalanyllysyllysyllysylleucylthreo…
inylphenylalanylglycylprolylalanylhist…
ginylleucylthreonylprolylisoleucylsery…
ylvalylglutamyltryptophylleucylhistidy…
tamylalanylalanylasparaginylarginylleu…
inylglutamylphenylalanylglycyltyrosylc…
lycylvalylalanyltyrosylserylarginylasp…
hreonylcysteinylarginylalanylthreonyla…
laspartylhistidylthreonylserylalanylth…
rtylglutamyllysylserylleucylvalylgluta…
lylglutamylglycylarginyllysylglycylleu…
ylglutamylleucylglutamylarginylmethion…
lleucylthreonylglycylvalylthreonylthre…
lysylglutaminyllysylprolylaspartylisol…
ylprolylvalylarginylvalylleucylglutamy…
lphenylalanylarginylcysteinylarginylva…
minylprolyllysylvalylasparaginyltrypto…
lutaminylleucylisoleucylarginyllysylse…
alylarginyltyrosylaspartylglycylisoleu…
leucylvalylaspartylcysteinyllysylseryl…
ylvalyllysylvalylthreonylalanylglutamy…
ylisoleucylglutamylhistidyllysylvalyll…
ylglutaminylarginylglutamylaspartylphe…
inylarginylalanylprolylglutamylprolyla…
tidylvalylhistidylglutamylprolylglycyl…
utamylvalylglutaminyllysylvalylasparty…
threonylglutamylthreonyllysylglutamylv…
nylglutamylarginylisoleucylthreonylhis…
ylglutamylserylglutamylglutamylleucyla…
ginylarginylthreonylglutamylglutamylgl…
leucylthreonylalanylvalylglutamylleucy…
lglutamylseryltyrosylglutamylglutamyll…
laspartylglutamylleucylleucylhistidylt…
lthreonylglutamylglutamylglutamyllysyl…
amylglycyllysylisoleucylthreonylisoleu…
rolylaspartyllysylisoleucylglutamylleu…
lalanylprolyllysylisoleucylphenylalany…
serylglutaminylthreonylvalylglycylglut…
idylphenylalanylarginylvalylarginylval…
lylglutamylcysteinylglutamyltryptophyl…
ysylisoleucylglutamylarginylserylaspar…
ltyrosyltryptophylprolylglutamylaspart…
leucylvalylisoleucylarginylaspartylval…
ylalanylserylisoleucylmethionylvalylly…
cylalanylglycylglutamylthreonylserylse…
leucylvalylglutaminylalanyllysylglutam…
anylthreonylglutaminylglutamylleucylgl…
ylglutamyllysylaspartylthreonylmethion…
lcysteinylglutamylthreonylserylglutamy…
ysyltryptophyltyrosyllysylaspartylglyc…
tamylglycylaspartyllysyltyrosylarginyl…
yllysylvalylhistidylphenylalanylleucyl…
ylaspartylthreonylserylaspartylalanylg…
lvalylleucylvalylglutamylaspartylgluta…
eonylalanyllysylleucylisoleucylvalylgl…
lphenylalanylvalyllysylglutamylleucylg…
alylprolylglutamylseryltyrosylserylgly…
soleucylvalylserylprolylglutamylaspara…
yptophyltyrosylhistidylasparaginylaspa…
paraginylglycyllysyltyrosylthreonyliso…
ycylarginylglutaminylasparaginylleucyl…
onyllysylglutamylaspartylglutaminylgly…
valylisoleucylaspartylglycyllysyllysyl…
llysylmethionyllysylprolylarginylproly…
aminylglycylleucylserylaspartylglutami…
laspartylisoleucylvalylglutaminylleucy…
glutamylserylvalylglutamylglycylvalylt…
ylglutaminylglutamylvalylglutaminylpro…
lisoleucylvalylisoleucylaspartyllysylg…
ylleucylisoleucylglutamylaspartylmethi…
anylglycylasparaginyltyrosylserylpheny…
lleucylglycylleucylserylthreonylserylg…
erylvalylaspartylvalylisoleucylthreony…
raginylvalylisoleucylglutamylglycylthr…
cysteinyllysylvalylserylvalylprolylasp…
yptophyltyrosylleucylasparaginylaspart…
rolylaspartylaspartylarginylvalylgluta…
lthreonyllysylglutaminylarginylleucylv…
onylhistidylalanylserylaspartylglutamy…
eucylvalylglycylarginylvalylglutamylth…
ylleucylserylvalylglutamyllysylisoleuc…
cylleucylarginylaspartylleucylthreonyl…
utaminylasparaginylvalylvalylphenylala…
histidylserylglycylisoleucylaspartylva…
lalanyllysylaspartyllysylglutamylisole…
yllysylisoleucylglutamylalanylhistidyl…
cylthreonylvalylleucylasparaginylmethi…
lutamylglycyllysyltyrosylthreonylpheny…
sparaginylmethionylthreonylserylglycyl…
lglycylalanylisoleucylseryllysylprolyl…
eonylvalylalanylglutamylserylglutaminy…
tamylcysteinylglutamylvalylalanylaspar…
lglutamyltryptophylleucylarginylaspart…
ucylthreonylasparaginylasparaginylisol…
tylglycylhistidyllysylarginylarginylle…
hreonyllysylleucylaspartylaspartylisol…
yrosyllysylvalylalanylthreonylseryllys…
ylvalylglutamylalanylvalyllysylisoleuc…
raginylleucylthreonylvalylthreonylglut…
lvalylphenylalanylthreonylvalylglutamy…
ginylvalyllysylglycylvalylglutaminyltr…
ycylvalylvalylleucylglutamylserylaspar…
leucylserylvalyllysylglycylthreonyliso…
eucyllysylasparaginylcysteinylalanylis…
lyltyrosylglycylphenylalanylarginylleu…
erylalanylarginylleucylhistidylvalylgl…
oleucyllysyllysylprolyllysylaspartylva…
raginylalanylthreonylvalylalanylphenyl…
istidylaspartylthreonylvalylprolylvaly…
llysylserylvalylglutamylisoleucyllysyl…
inylleucylvalylserylglutamylarginyllys…
leucylglutaminylasparaginylisoleucylse…
lutamyltyrosylthreonylalanylvalylvalyl…
inyllysylalanyllysylleucylphenylalanyl…
isoleucylthreonyllysylthreonylmethiony…
alylprolylglutamylthreonyllysylthreony…
teinylglutamylvalylserylhistidylphenyl…
thionyltryptophylleucyllysylasparaginy…
ylmethionylserylglutamyllysylphenylala…
ylglycyllysylleucylhistidylglutaminyll…
araginylthreonylserylthreonylglutamyla…
reonylphenylalanylvalylcysteinylglycyl…
erylalanylthreonylleucylthreonylvalylt…
eucylthreonylserylmethionylleucyllysyl…
lutamylglutamyllysylaspartylthreonylis…
valylthreonylvalylasparaginyltyrosylgl…
syltryptophylleucyllysylasparaginylgly…
threonylaspartyllysylcysteinylglutamin…
lleucylthreonylhistidylserylleucylaspa…
alylhistidylphenylalanylglycylaspartyl…
phenylalanylvalylalanylglycyllysylalan…
ylleucyltyrosylvalylglutamylalanylargi…
lanylarginyllysylhistidylisoleucyllysy…
lutamyllysyllysylarginylalanylmethiony…
mylvalylserylglutamylprolylaspartyliso…
phylmethionyllysylaspartylaspartylglut…
ucylthreonylaspartylarginylisoleucylly…
lysyltyrosylvalylhistidylarginylleucyl…
rginylmethionylserylaspartylalanylglyc…
nylglycylglycylasparaginylvalylserylth…
valylglutamylglycylarginylaspartylvaly…
cyllysyllysylglutamylvalylglutaminylva…
arginylalanylvalylvalylglutamylphenyla…
ylaspartylaspartylvalylaspartylalanylh…
ylglycylisoleucylglutamylisoleucylaspa…
lutaminylglutamylarginylhistidyllysylt…
nylisoleucylhistidylarginylmethionylph…
eonylarginylglutaminylserylaspartylala…
nylalanylvalylalanylglycylarginylaspar…
lleucyltyrosylvalylasparaginylalanylpr…
alylleucylglutaminylglutamylleucylglut…
minylserylglycyllysylprolylalanylargin…
nylisoleucylserylglycylarginylprolylgl…
yptophyltyrosyllysylglutamylglutamylgl…
ycylphenylalanyllysylcysteinyllysylphe…
ylglutaminylglutamyltyrosylthreonylleu…
nylphenylalanylprolylglutamylaspartyla…
einylglutamylalanyllysylasparaginylasp…
ylthreonylserylalanylserylleucylserylv…
lvalylserylprolylaspartylglutaminylglu…
lylprolylalanylisoleucylisoleucylthreo…
reonylvalylthreonylserylglutamylglycyl…
alanylglutaminylcysteinylarginylvalyls…
ylvalylseryltryptophyltyrosylseryllysy…
olylserylarginylphenylalanylphenylalan…
lphenylalanylglutamylaspartylthreonylt…
ucylalanylglutamylalanyltyrosylprolylg…
yltyrosylthreonylphenylalanylvalylalan…
glycylglutaminylvalylserylserylthreony…
glutamylalanylprolylglutamylserylisole…
oleucylglutamylglutaminylglutamylisole…
nyllysylglutamylphenylalanylserylseryl…
lutamylglutamylglutamylglycylleucylhis…
minylleucylseryllysylisoleucylasparagi…
ucylleucylserylglutamylserylprolylvaly…
anylaspartylserylglutamyllysylglutamyl…
phenylalanylisoleucyllysylglutamylvaly…
eucylserylmethionylglycylaspartylvalyl…
nylvalylisoleucylglycylisoleucylprolyl…
tryptophylphenylalanylphenylalanylaspa…
nylprolylserylalanylaspartyltyrosyllys…
rtylglycylaspartylaspartylhistidylsery…
ylalanylthreonyllysylleucylglutamylasp…
hreonylcysteinylmethionylalanylserylas…
threonylisoleucylcysteinylserylalanylt…
ylseryllysylglycylglutamylglycylhistid…
onylglutamylserylalanylvalylalanyllysy…
ylglycylprolylcysteinylprolylprolylhis…
lleucyllysylprolylisoleucylarginylcyst…
olylalanylisoleucylphenylalanylglutamy…
tamylprolylalanylprolylthreonylvalylth…
utamylasparaginyllysylglutaminylleucyl…
yrosylthreonylisoleucylisoleucylhistid…
lserylglycylthreonylphenylalanylisoleu…
utaminylarginylglutamylaspartylserylgl…
lysylalanylglutamylasparaginylmethiony…
ysteinylalanylalanylglutamylleucylleuc…
threonylaspartylmethionylthreonylaspar…
yllysylserylthreonylprolylglutamylalan…
lprolylglutaminylthreonylprolylleucyll…
alanylleucylaspartylserylglutamylgluta…
lphenylalanylvalyllysylaspartylthreony…
ucylisoleucylthreonylglutamylglutamyla…
lseryltyrosylglutamylhistidylisoleucyl…
lleucylserylserylglutaminylleucylproly…
ylleucylglutaminylserylisoleucylleucyl…
ylthreonylprolylglutamylserylthreonyla…
teinylisoleucylasparaginylglycylseryli…
nylprolylleucyllysylglutamylprolylsery…
eucylglutaminylisoleucylvalylglutaminy…
alanylseryllysylglutamylglycylisoleucy…
mylprolylglutamylthreonylglutaminylala…
glutamyllysylisoleucylphenylalanylprol…
lglutamylglutaminylisoleucylasparaginy…
olylleucyllysylthreonylleucylleucylala…
raginyltyrosylprolylglutaminylserylser…
ionylhistidylseryltyrosylleucylthreony…
lylleucylserylleucyllysylglutamyllysyl…
sparaginylarginylglutamylglutaminylarg…
sylglutaminylglutamylalanylglutaminyls…
lglutaminylserylleucylalanylglutamylgl…
lglutaminylserylprolylaspartylvalylmet…
asparaginyltyrosylglutamylprolylleucyl…
ylcysteinylthreonylglutamylglycylglycy…
mylserylalanylasparaginylprolylleucylg…
minylaspartylserylalanylvalylarginylis…
erylleucylarginylphenylalanylprolylleu…
lglutaminylvalylleucylleucyllysylgluta…
araginylvalylvalylmethionylprolylproly…
ylglutamylseryllysylarginylglutamylpro…
lylglutaminylglutamylvalylglutaminylgl…
llysylglutamylserylleucylleucylserylgl…
glutaminylarginylleucylasparaginylleuc…
cysteinylarginylalanylleucylglutaminyl…
lglutaminylprolylglycylleucylphenylala…
inylasparaginylisoleucylglutamyllysylv…
lasparaginylisoleucylthreonylglutaminy…
ucylmethionylcysteinylmethionyltyrosyl…
serylvalylthreonylglutamylglutamylvaly…
lglutamylaspartylvalylaspartylprolylgl…
eucyllysylmethionylglutamylleucylargin…
ylisoleucylisoleucyltyrosylglutamylglu…
ylthreonylalanylglutamylglycylprolylar…
lycylalanyllysylthreonylserylleucylglu…
artylserylphenylalanylserylglycylseryl…
soleucylthreonylglutamylprolylglutamyl…
lisoleucylserylthreonylglutamylglutamy…
aginylvalylglutaminylserylarginylvalyl…
eonylprolylvalylthreonyllysylglycylval…
spartylglutamyllysylglutaminylaspartyl…
glutamylglutamyllysylglutamylglutamyls…
reonylglutamylglutamylvalylalanylthreo…
tamylalanylglutamylglycylglycylleucyli…
prolylmethionylisoleucylhistidylthreon…
valylserylglutamylglutamylglycylaspart…
nylthreonylserylisoleucylthreonylaspar…
aginyltryptophyltyrosylphenylalanylglu…
lylserylaspartylglutamyllysylphenylala…
partylglutaminylasparaginylthreonyltyr…
artyllysylvalylasparaginylthreonylglut…
lglutamyltyrosylvalylcysteinylglutamyl…
lglycyllysylthreonylalanylthreonylsery…
llysylarginylalanylalanylprolylvalylis…
utamylprolylleucylglutamylvalylalanyll…
lphenylalanylthreonylcysteinylglutamyl…
lasparaginylvalylarginylphenylalanylgl…
alanylglycylarginylglutamylisoleucylty…
einylserylisoleucylarginylserylserylly…
glutamylisoleucylleucylarginylthreonyl…
ylglycylglutamyltyrosylthreonylcystein…
yltyrosylglycylserylvalylserylcysteiny…
ylvalylthreonylvalylprolylglycylglycyl…
leucylleucylprolylglutamylarginyllysyl…
utamylvalylvalylleucyllysylserylvalyll…
mylglutamylglutamylglutamylprolyllysyl…
glutamyllysylvalyllysyllysylprolylalan…
olylprolyllysylprolylvalylglutamylglut…
lvalylthreonyllysylarginylglutamylargi…
ylthreonyllysylvalylprolylglutamylisol…
ylleucylprolylalanylprolylglutamylprol…
nylglutamylvalyllysylthreonylisoleucyl…
lprolylglutamylprolylthreonylprolyliso…
ylvalylprolylvalylvalylglycyllysyllysy…
lyllysylglutamylglutamylalanylalanylly…
lysylglycylvalylprolyllysyllysylthreon…
lalanylglutamylarginylarginyllysylleuc…
cylglutamyllysylprolylprolylaspartylgl…
nyltyrosylglutaminylleucyllysylalanylv…
lyllysylglutamylisoleucyllysylaspartyl…
tamylserylglutamylphenylalanylvalylgly…
lanylglutamylcysteinylleucylvalylseryl…
hreonylthreonyltryptophylmethionyllysy…
eucylarginylglutamylserylprolyllysylhi…
lanylaspartylglycyllysylaspartylarginy…
cylaspartylvalylglutaminylleucylseryla…
hreonylcysteinylvalylleucylarginylleuc…
ylthreonylserylthreonylalanyllysylleuc…
rolylvalylarginylphenylalanylvalyllysy…
amylvalylthreonylvalylvalyllysylglycyl…
serylcysteinylglutamylleucylasparaginy…
alyltryptophylarginyllysylaspartylglyc…
ysylprolylglycylarginylisoleucylvalylp…
ylmethionylarginylalanylleucylthreonyl…
spartylaspartylthreonylaspartylalanylg…
reonylvalylglutamylasparaginylalanylas…
ysteinylserylserylcysteinylvalyllysylv…
nylaspartyltryptophylleucylvalyllysylp…
inylhistidylvalyllysylprolyllysylglycy…
lalanylcysteinylaspartylisoleucylalany…
inylisoleucyllysyltryptophylphenylalan…
lisoleucylprolylalanylglutamylprolylas…
mylisoleucylleucylarginylaspartylglycy…
ucyllysylisoleucyllysylasparaginylalan…
oleucylalanylglutamyltyrosylalanylvaly…
ylarginyltyrosylprolylalanyllysylleucy…
lglutamylvalylglutamylleucylleucyllysy…
ylthreonylisoleucyltyrosylglutamyllysy…
ylaspartylalanylglutamylisoleucylseryl…
ylglycylglutaminyltryptophyllysylleucy…
inylprolylserylprolylthreonylcysteinyl…
lglycylglycyllysylarginylphenylalanyll…
yllysylleucylaspartylglutaminylalanylg…
aminylalanylleucylasparaginylalanyliso…
ylleucylthreonylvalyllysylglutamylisol…
anylalanylvalylprolylleucyllysylaspart…
rginylarginylglutaminylalanylarginylph…
cylthreonylarginylglutamylalanylaspara…
ysylglycylprolylaspartylisoleucylisole…
nylalanylaspartylisoleucylisoleucylala…
isoleucylleucylvalylisoleucylasparagin…
ylaspartylaspartylglutamylglycylvalylt…
utamylglycyllysyllysylthreonylserylala…
reonylglycylisoleucylarginylleucyllysy…
ucylglutamylaspartylglutaminylthreonyl…
eonylalanylthreonylphenylalanylvalylcy…
lutamyllysylmethionylhistidylvalylvaly…
inylaspartylalanyllysylleucylhistidylt…
cylisoleucylserylserylglutamylglycylly…
mylmethionyllysylglutamylvalylthreonyl…
lglutaminylisoleucyllysylalanylglutami…
ylthreonylalanylglutaminylleucyllysylv…
lyltyrosylphenylalanylthreonylvalyllys…
ylalanylvalylglutamyllysylaspartylglut…
teinylglutamylvalylseryllysylaspartylv…
lalanyllysylaspartylglycylglutamylglut…
lysyltyrosylserylisoleucyllysylalanyla…
oleucylleucyllysylisoleucyllysyllysyla…
ylglycylglutamyltyrosylvalylcysteinyla…
tyllysylthreonyllysylalanylasparaginyl…
inylleucylisoleucylglutamylvalylglutam…
ylglutamylvalylphenylalanylvalylglycyl…
lalanylglutamylisoleucylglutamylleucyl…
tidylglycylglutaminyltryptophyllysylle…
ylthreonylalanylserylprolylaspartylcys…
tamylaspartylglycyllysyllysylhistidyli…
ylasparaginylcysteinylglutaminylleucyl…
ylvalylserylphenylalanylglutaminylalan…
alanylalanylasparaginylleucyllysylvaly…
leucylphenylalanylisoleucylthreonylpro…
ylphenylalanylglutamyllysylaspartylglu…
lcysteinylglutamylvalylserylarginylglu…
larginyltryptophylleucyllysylglycylthr…
eonylglycylaspartylaspartylarginylphen…
laspartylglycylthreonyllysylhistidylse…
lalanylalanylphenylalanylglutamylaspar…
nylphenylalanylglutamylalanylglutamyla…
ycyllysylleucylisoleucylisoleucylgluta…
lphenylalanylleucylthreonylprolylleucy…
sylglutamyllysylglutamylserylalanylval…
leucylserylhistidylaspartylasparaginyl…
lphenylalanyllysylasparaginylaspartylg…
nylthreonylarginylserylvalylserylmethi…
llysylthreonylhistidylserylisoleucylth…
ylserylisoleucylaspartylaspartylthreon…
lylglutamylalanylmethionylglycylmethio…
cylthreonylvalylleucylglutamylglycylas…
onylglycyllysylleucylglutaminylasparty…
lysylaspartylglutamylvalylisoleucylleu…
ucylseryllysylalanylaspartylalanylprol…
ysylaspartylglycyllysylglutamylisoleuc…
lanylvalylisoleucyllysylthreonylaspart…
eucylisoleucylleucyllysyllysylalanylle…
ylglutaminyltyrosylthreonylcysteinylas…
yllysylthreonylserylglycyllysylleucyla…
inylglutamylisoleucyllysylleucylvalyla…
lglutamylvalylmethionylglutamylthreony…
lalanylglutamylthreonylglutamylisoleuc…
eucylhistidylalanylasparaginyltryptoph…
nylleucylleucylglutaminylthreonylproly…
lysylglutamylglutamylglycyllysylisoleu…
stidylasparaginylcysteinylarginylleucy…
ycylvalylaspartylphenylalanylglutaminy…
erylserylalanylhistidylleucylarginylva…
glycylleucylleucylarginylprolylleucyll…
nylalanylglycylglutamylthreonylalanylt…
lglutamylleucylseryltyrosylglutamylasp…
yptophyltyrosylleucyllysylglycyllysyll…
yllysylvalylvalylprolylarginylserylglu…
ylleucylthreonylleucylarginylaspartylv…
ylglycylglutamylvalylglutaminylleucylt…
nyllysylthreonylhistidylalanylasparagi…
amylprolylprolylvalylglutamylphenylala…
laspartylglutaminylthreonylvalylglutam…
lvalylleucylglutamylcysteinylglutamylv…
alanyllysylvalyllysyltryptophylphenyla…
glutamylisoleucylleucyllysylseryllysyl…
lanylaspartylglycylarginylvalylarginyl…
partylcysteinylthreonylprolylglutamyla…
lthreonylcysteinylaspartylalanyllysyla…
ylcysteinylasparaginylleucylasparaginy…
lglutamylphenylalanylleucylarginylprol…
minylvalylarginylglutamyllysylglutamyl…
lutamylcysteinylglutamylleucylserylarg…
alyllysyltryptophylphenylalanyllysylas…
lysyllysylglycyllysyllysyltyrosylaspar…
ylalanylvalylarginylisoleucylleucylval…
lleucylleucylaspartylaspartylglutamyla…
lutamylvalylarginylthreonylalanylargin…
lthreonylvalylleucylglutamylglutamylgl…
yllysylasparaginylleucylalanylasparagi…
mylthreonylaspartylthreonylisoleucylly…
lseryllysylprolylglycylalanylglutamylv…
glycylaspartylglutamylglutamylisoleucy…
inyltyrosylglutamylisoleucylleucylthre…
ylisoleucylleucylvalylisoleucylglutami…
lutamylaspartylalanylglycylasparaginyl…
eucylprolylserylserylarginylthreonylas…
tidylglutamylleucylalanylalanylglutamy…
lylglutaminylasparaginylleucylglutamyl…
yllysylalanylglutamylphenylalanylvalyl…
utamylserylphenylalanylprolylvalylglut…
laspartyllysylthreonylleucylglutamylse…
ylvalylisoleucylalanylaspartylglycylly…
llysylaspartylalanylthreonylleucylglut…
yltyrosylvalylvalylmethionylvalylglycy…
nylhistidylleucylthreonylvalylisoleucy…
lvalylvalylprolylleucyllysylaspartylth…
aminylglutaminylglutamylvalylvalylphen…
lvalylasparaginylthreonylglutamylglycy…
enylalanylarginylasparaginylglutamylgl…
partylserylseryllysyltyrosylisoleucyli…
ylleucylvalyltyrosylthreonylleucylargi…
stidylleucylaspartylaspartylglutaminyl…
valylserylleucylthreonylasparaginylhis…
ylvalyllysylserylalanylalanylasparagin…
mylglutamylaspartylleucylarginylisoleu…
partylisoleucylglutamylthreonylmethion…
nylphenylalanyltryptophylcysteinyllysy…
aginylvalylthreonylleucyllysyltryptoph…
tamylglutamylvalylprolylphenylalanylas…
yrosylarginylvalylaspartyllysyltyrosyl…
lisoleucyllysylaspartylcysteinylglycyl…
lycylglutamyltyrosylisoleucylvalylthre…
ysylserylvalylalanylglutamylleucylleuc…
rolylthreonylglutamylphenylalanylvalyl…
tylglutaminylthreonylvalylthreonylglut…
nylvalylphenylalanylserylcysteinylglut…
ylalanylasparaginylvalyllysyltryptophy…
inylglutamylisoleucyllysylglutamylglyc…
lglutamyllysylaspartylglycylserylisole…
soleucyllysylaspartylcysteinylarginyll…
nylglutamyltyrosylalanylcysteinylglycy…
erylarginylalanylarginylleucylphenylal…
rolylvalylglutamylisoleucylisoleucylar…
isoleucylleucylglutamylalanylprolylgly…
anylleucylalanylglutamylleucylasparagi…
alylglutaminyltryptophylleucylarginyla…
valylvalylglutaminylglycylaspartyllysy…
ylserylglutamylglycyllysylisoleucylhis…
ylcysteinylaspartylisoleucyllysylproly…
tamyltyrosylarginylphenylalanylisoleuc…
lanylarginylalanyllysylleucylglutamyll…
soleucyllysylthreonylalanylaspartylglu…
rtylvalylglycyllysylprolylleucylthreon…
spartylalanyltyrosylprolyllysylalanylg…
ylalanyllysylglutamylasparaginylglutam…
eonylisoleucylaspartylthreonylthreonyl…
ylphenylalanylarginylisoleucylleucylgl…
llysylglycylarginyltyrosyllysylisoleuc…
ysylhistidylglycyllysylalanylglutamylg…
ylleucyllysylvalylisoleucylaspartylval…
araginylleucylglutamylvalylthreonylglu…
ycylglutamylvalylserylleucylalanyltryp…
hreonylaspartylglycylglycylseryllysyli…
valylglutamylarginylarginylaspartyliso…
tophylvalylleucylalanylthreonylasparty…
lglutamylphenylalanylthreonylvalylthre…
ylglycylvalylglutamyltyrosylleucylphen…
nylasparaginylarginylvalylglycylthreon…
threonylaspartylasparaginylprolylvalyl…
sylaspartylvalylprolylglycylprolylprol…
leucylthreonylaspartylvalylasparaginyl…
leucylthreonyltryptophylglutamylprolyl…
glycylalanylglutamylisoleucylthreonyla…
amylleucylarginylaspartyllysylthreonyl…
rtylthreonylalanylmethionylthreonylval…
ylserylalanylthreonylvalylthreonylaspa…
nylglutamyltyrosylserylphenylalanylarg…
araginylarginylisoleucylglycylvalylgly…
onylprolylphenylalanylvalyllysylvalyla…
larginylprolylserylprolylprolylvalylas…
partylglutaminylthreonylglutaminylsery…
ptophylglutamylprolylprolylleucyllysyl…
eucylleucylglycyltyrosylisoleucylisole…
lglutamylglycyllysylaspartylasparaginy…
lasparaginylmethionyllysylleucylvalylp…
ysylvalylthreonylglycylleucylglutamyll…
ucyltyrosylarginylvalylserylalanylglut…
ylserylaspartylprolylserylglutamylisol…
ylalanylaspartylaspartylalanylphenylal…
ionylaspartylleucylserylalanylphenylal…
ylvalylisoleucylvalylprolylasparaginyl…
cylvalylprolylserylthreonylglycyltyros…
threonyltryptophylcysteinylphenylalany…
amylthreonylglycylaspartylarginylvalyl…
rylalanyltyrosylalanylglutamylleucylva…
larginylserylaspartyllysylglycylisoleu…
glutamylasparaginylarginylvalyllysylth…
soleucylaspartylvalylasparaginylvalyli…
nylprolyllysylglutamylleucyllysylpheny…
nyllysylaspartylserylvalylhistidylleuc…
rolylaspartylaspartylaspartylglycylgly…
yrosylvalylvalylglutamyllysylarginylgl…
ltryptophylthreonyllysylvalylmethionyl…
partylleucylglutamylphenylalanylthreon…
taminylglycyllysylglutamyltyrosylleucy…
nylarginylasparaginyllysylcysteinylgly…
tyrosylvalylaspartylglutamylprolylvaly…
rolylalanylthreonylvalylprolylaspartyl…
llysyltryptophylarginylaspartylarginyl…
ucylphenylalanylleucylthreonyltryptoph…
nylaspartylglycylglycylserylarginyliso…
lylglutamylarginylcysteinylprolylargin…
lvalylalanylcysteinylglycylglutamylpro…
methionylglutamylvalylthreonylglycylle…
tophyltyrosylalanyltyrosylarginylvalyl…
ylglutaminylglycylalanylseryllysylprol…
lglutamylisoleucylglutaminylalanylvaly…
alanylprolylglutamylisoleucylphenylala…
ucylalanylglycylleucylthreonylvalyllys…
lglutamylleucylprolylalanylthreonylval…
prolyllysylisoleucylthreonyltryptophyl…
lisoleucylleucyllysylglutaminylasparty…
ucylglutamylasparaginylvalylprolyllysy…
leucylvalylaspartylseryllysylarginylse…
rosylisoleucylisoleucylglutamylalanylv…
arginylalanylthreonylalanylvalylvalylg…
spartyllysylprolylglycylprolylprolylal…
ucylthreonylaspartylvalylthreonylaspar…
eucylthreonyltryptophylasparaginylprol…
ylglycylseryllysylisoleucylthreonylasp…
ginylarginylalanylthreonylaspartylsery…
ylleucylserylserylthreonylvalyllysylas…
yllysylalanylthreonyllysylleucylisoleu…
rosylisoleucylphenylalanylarginylvalyl…
ionyltyrosylglycylalanylglycylglutamyl…
lylisoleucylthreonylalanyllysyltyrosyl…
lprolylglycylprolylprolylthreonylargin…
isoleucylthreonyllysylaspartylalanylva…
cysteinylglutamylprolylaspartylasparty…
leucylthreonylglycyltyrosyltryptophylv…
olylaspartylthreonylaspartyllysyltrypt…
yllysylmethionylprolylvalyllysylaspart…
yllysylglycylleucylthreonylasparaginyl…
alanylarginylvalylleucylalanylglutamyl…
glycyllysylprolylseryllysylserylthreon…
eucyllysylaspartylprolylisoleucylaspar…
ylglycyllysylprolylthreonylvalyllysyla…
lvalylarginylleucylasparaginyltryptoph…
ylaspartylglycylglycylalanyllysylisole…
cylglutamylmethionylleucyllysylthreony…
tophylvalylarginylvalylalanylglutamylg…
taminylhistidylleucylleucylprolylglycy…
minylglutamyltyrosylserylphenylalanyla…
ginyllysylalanylglycylglutamylserylglu…
aspartylprolylvalylleucylcysteinylargi…
prolylserylprolylprolylarginyltryptoph…
aginylisoleucylthreonyllysylasparaginy…
ryptophylthreonylvalylprolylglutamylly…
soleucylthreonylasparaginyltyrosylisol…
tylvalylarginylarginyllysylglycyltrypt…
lthreonylthreonylvalyllysylaspartylthr…
eonylprolylleucylthreonylglutamylglycy…
larginylvalylalanylalanylglutamylaspar…
ylserylaspartyltyrosylthreonylglutamyl…
leucylalanyllysylaspartylthreonylpheny…
prolylprolyltyrosylalanylleucylalanylv…
arginylhistidylvalylaspartylleucyllysy…
lasparaginylaspartylglycylglycylarginy…
rosylvalylisoleucylglutamyllysyllysylg…
rginyltryptophylvalyllysylalanylglycyl…
rtylcysteinylasparaginylphenylalanylar…
eucylglutamylglycylthreonylglutamylval…
alylarginylalanylglutamylasparaginylgl…
ylprolylserylglutamylprolylthreonylglu…
lutamylaspartylprolylthreonylserylprol…
rtylleucylhistidylvalylthreonylasparty…
oleucylalanylisoleucylalanyltryptophyl…
aginylglycylglycylserylprolylisoleucyl…
glutamylmethionylcysteinylprolylvalylg…
lmethionylarginylvalylasparaginylseryl…
leucyllysylphenylalanyllysylvalylgluta…
partyllysylglutamyltyrosylvalylleucyla…
ginylalanylisoleucylglycylvalylserylgl…
erylglutamylasparaginylvalylvalylalany…
yllysylprolylthreonylisoleucylaspartyl…
tylisoleucylisoleucylvalylisoleucylglu…
isoleucylprolylvalylprolylphenylalanyl…
threonylvalylseryltryptophylhistidylly…
lysylalanylserylaspartylarginylleucylt…
artylhistidylisoleucylserylalanylhisti…
rylvalylarginylalanylaspartylalanylgly…
lthreonylleucylglutamylasparaginyllysy…
nylserylisoleucylasparaginylvalyllysyl…
cylprolylcysteinyllysylaspartylisoleuc…
threonyllysylserylserylcysteinyllysyll…
ylprolylglutamylphenylalanylaspartylgl…
ucylhistidyltyrosylvalylleucylglutamyl…
rginylarginylthreonyltyrosylisoleucylp…
mylasparaginyllysylleucylseryltryptoph…
soleucylprolylasparaginylglycylglutamy…
inylvalyllysylalanylvalylasparaginylly…
yrosylisoleucylglutamylleucyllysylaspa…
utaminylaspartylprolyllysylglutaminylp…
laspartylvalylglutamylvalylhistidylasp…
lalanylmethionylthreonylisoleucylthreo…
ltyrosylaspartylglycylglycylseryllysyl…
eucylisoleucylglutamyllysylisoleucylal…
nyltryptophyllysylarginylcysteinylaspa…
rolylisoleucylleucylthreonyltyrosylthr…
lglutamylglycyllysylglutamyltyrosylglu…
nylalanylglutamylasparaginylalanylalan…
lserylarginylalanylthreonylprolylproly…
olylisoleucylaspartylalanylprolyllysyl…
serylleucylglutamylvalyllysylarginylgl…
leucylaspartylalanylserylisoleucylsery…
onylisoleucylthreonyltryptophylisoleuc…
alylisoleucylvalylprolylglutamylglutam…
lanylprolylleucylvalylarginylarginylar…
inylglutamylglutamylglutamylprolylphen…
onylglutaminylarginylleucylserylisoleu…
ylglycylglutamylserylglutaminylleucyla…
ylarginylprolylaspartylhistidylglycyll…
valylglutamylasparaginylaspartylhistid…
rolylcysteinylthreonylvalylserylvalyll…
olylprolylisoleucylasparaginylphenylal…
ylisoleucylarginyllysylthreonylserylva…
utamylprolylprolylleucylaspartylaspart…
lisoleucylasparaginyltyrosylthreonylle…
threonyllysylprolylaspartylserylglutam…
onylserylthreonylleucylarginylhistidyl…
onyllysylleucylisoleucylglutamylglycyl…
nylarginylvalylarginylalanylglutamylas…
rolylglycylprolylprolylcysteinylvalyls…
ylaspartylprolylphenylalanylglycylprol…
llysylprolylisoleucylvalylglutamylaspa…
rylmethionylleucylvalyllysyltryptophyl…
tylasparaginylglycylserylprolylisoleuc…
ylglutamyllysylarginylglutamylvalylasp…
phylserylarginylvalylasparaginyllysyls…
ucyllysylalanylasparaginylvalylasparty…
ucylthreonyltyrosylvalylphenylalanylar…
paraginylalanylalanylglycylprolylglycy…
serylaspartylprolyllysylthreonylalanyl…
lprolylprolylglycylprolylprolylisoleuc…
lthreonylserylserylthreonylthreonyliso…
hylglutamylprolylprolylalanylphenylala…
tamylisoleucylvalylglycyltyrosylphenyl…
eucylvalylglycylthreonylasparaginyllys…
reonylglutamyllysylmethionylisoleucyll…
reonylvalyllysylglutamylisoleucylargin…
yllysylleucylarginylvalylserylalanylva…
tamylglycylprolylprolylglycylglutamylt…
lvalylalanylglutamylprolylglutaminylgl…
ylleucylaspartylvalylserylvalyllysylgl…
cylmethionylalanylglycyllysylthreonyll…
lylvalylthreonylglycylarginylprolylval…
lthreonyllysylglutamylglutamylglycylgl…
ginylvalylvalylisoleucylaspartylaspara…
lutamylleucylisoleucylisoleucyllysylas…
tylhistidylglycylarginyltyrosylvalylis…
ginylserylcysteinylglycylseryllysylphe…
alylglutamylvalylphenylalanylaspartylv…
partylleucyllysylprolylvalylvalylthreo…
cysteinylleucylleucylasparaginyltrypto…
rtylaspartylglycylglycylserylglutamyli…
soleucylisoleucylglutamylarginyllysyla…
threonyltryptophylarginylglutaminylpro…
larginylseryllysylcysteinylaspartyliso…
tamylglycylglutaminylglutamyltyrosylly…
lalanyllysylasparaginyllysylphenylalan…
valylglutamylisoleucylglycylprolylisol…
lleucylglycylprolylprolylthreonylseryl…
tyrosylthreonylglutamylarginylglutamin…
onylleucylaspartyltryptophyllysylgluta…
cylglycylserylprolylisoleucylglutaminy…
tamyllysylarginylarginylhistidylaspart…
utamylarginylvalylasparaginyllysylargi…
eonylserylphenylalanylleucylvalylgluta…
lhistidylglutaminylmethionyltyrosylglu…
lanylvalylasparaginylglutamylisoleucyl…
rylleucylprolylleucylasparaginylvalylv…
rtylglutamylvalylprolylprolylthreonyli…
ylvalylarginylglycylaspartylthreonylis…
lutamylprolylvalylhistidylisoleucylpro…
lleucylprolylmethionylprolyllysylisole…
araginylglutamylthreonylvalylisoleucyl…
alanylleucylglutaminylisoleucylthreony…
inylserylglutamylalanyllysylthreonylgl…
ylalanylvalylarginylglutamylaspartylly…
ylthreonylalanylserylasparaginylarginy…
arginylasparaginylvalylhistidylvalylgl…
olylserylprolylprolylarginylasparaginy…
soleucyllysylalanylglutamylserylcystei…
spartylalanylprolylleucylaspartylaspar…
eucylthreonylhistidyltyrosylvalylisole…
nylserylarginyllysyllysylalanylglutamy…
eonylasparaginylthreonylalanylvalylglu…
ucyltryptophyllysylleucylisoleucylprol…
lglutamylphenylalanylarginylvalylargin…
lglycylisoleucylserylaspartylglutamylc…
lvalylisoleucylglutaminylaspartylproly…
olylprolylglycyllysylprolyllysylvalyll…
ylserylmethionylleucylvalylseryltrypto…
tylasparaginylglycylglycylserylprolyli…
phylleucylglutamyllysylarginylglutamyl…
ptophylserylarginylvalylserylarginylal…
ylglycylleucyllysylglycylvalylglutamyl…
rginylleucylleucylglutamylglycylvalyll…
ginylalanylmethionylalanylisoleucylasp…
glycylprolylprolylserylglutamylprolyls…
ylglycylaspartylprolylisoleucylphenyla…
serylcysteinylprolylglutamylvalyllysyl…
lisoleucylserylleucylglycyltryptophyll…
glycylglycylserylprolylisoleucyllysylg…
ethionylglutaminylglutamylglutamylglyc…
llysylarginylvalylasparaginylglutamylp…
reonylthreonylcysteinylglutamylcystein…
lysylglutamylleucylarginyllysyltyrosyl…
lalanylvalylasparaginylglutamylalanylg…
ylaspartylthreonylthreonylglycylglutam…
rtylisoleucylglutaminylglutamylglutamy…
leucylaspartylisoleucylglycylalanylglu…
cysteinyllysylalanylglycylserylglutami…
lanylvalylisoleucyllysylglycylarginylp…
ryptophylglutamylphenylalanylaspartylg…
hionyllysylaspartylglycylvalylhistidyl…
rtylalanylglutaminylleucylglutamylthre…
erylvalylisoleucylisoleucylisoleucylpr…
rylhistidylthreonylglycyllysyltyrosyls…
araginyllysylalanylglycylglutaminyllys…
larginylvalyllysylvalylmethionylaspart…
laspartylleucyllysylvalylserylaspartyl…
cysteinylarginylleucylseryltryptophyll…
aspartylglycylglycylaspartylarginyliso…
cylglutamyllysylarginylthreonylisoleuc…
ylthreonyllysylvalylasparaginylprolyla…
threonylphenylalanylvalylvalylprolylas…
aminylglutaminyltyrosylphenylalanylphe…
lutamylasparaginylarginylphenylalanylg…
ylglutamylthreonylisoleucylglutaminyla…
aspartylprolylisoleucyltyrosylprolylpr…
sylleucyllysylisoleucylglycylleucyliso…
nylvalylhistidylleucylseryltryptophyll…
artylglycylglycylserylprolylvalylthreo…
tamylcysteinylleucylalanyltryptophylas…
ysyllysylglutamylalanyltryptophylargin…
ylarginylaspartylvalylglutamylglutamyl…
lvalylglutamylaspartylleucylvalylgluta…
mylphenylalanylarginylvalyllysylalanyl…
alylseryllysylprolylserylalanylthreony…
cysteinylglutaminylarginylprolylaspart…
ylaspartylleucyllysylglutamylphenylala…
utamylglycylthreonylasparaginylvalylas…
soleucyllysylglycylvalylprolylphenylal…
ptophylphenylalanyllysylalanylprolylpr…
inyllysylglutamylprolylvalylleucyltyro…
araginyllysylleucylvalylvalylaspartyla…
cylvalylisoleucylprolylglutaminylseryl…
glycylleucyltyrosylthreonylisoleucylth…
inylleucylglycylthreonylalanylseryllys…
araginylvalylleucylglycylarginylprolyl…
isoleucyllysylphenylalanylglutamylsery…
methionylthreonylleucylseryltryptophyl…
ylaspartylglycylglycylseryllysylisoleu…
soleucylglutamyllysylarginylglutamylal…
tryptophylvalylhistidylvalylserylseryl…
lthreonyltyrosylthreonylisoleucylproly…
tidylglutamyltyrosylvalylphenylalanyla…
minylasparaginyllysyltyrosylglycylisol…
rtylserylglutamylprolylglutamylthreony…
ylalanylserylvalylprolylglycylalanylpr…
lserylserylvalylthreonylarginylasparag…
raginyltryptophylglutamylglutamylproly…
lserylprolylvalylthreonylglycyltyrosyl…
sylaspartylthreonylthreonylseryllysyla…
paraginylarginylaspartylprolylisoleucy…
glycylvalylseryltyrosyllysylvalylthreo…
cylserylaspartyltyrosylglutaminylpheny…
leucylasparaginylalanylalanylglycylval…
ylserylaspartylprolylalanylthreonylala…
anylprolylprolylglycylprolylprolylphen…
artyltryptophylthreonyllysylserylseryl…
hylserylprolylprolylleucyllysylasparty…
lglycyltyrosylisoleucylvalylglutamylty…
ylglutamylglutamyltryptophylglutamylly…
valylarginylglycylthreonyllysylleucylv…
lutamylglycylalanylphenylalanyltyrosyl…
lanylvalylasparaginylisoleucylalanylgl…
ycylglutamylvalylthreonylaspartylvalyl…
rtylarginylleucylvalylserylprolylaspar…
anylserylvalylarginylaspartylarginylis…
ylglycylvalylisoleucylarginylisoleucyl…
cyllysylprolylprolylprolylthreonylvaly…
onylasparaginylglutamylarginylthreonyl…
lthreonylisoleucylglutamylthreonylthre…
ethionylvalylisoleucyllysylasparaginyl…
idylglutaminylglycylvalyltyrosylseryll…
utamylalanylglycylglutamylarginyllysyl…
laspartylvalylleucylaspartylvalylproly…
lylphenylalanylleucylalanylhistidylasp…
utamylserylcysteinyllysylleucylthreony…
lutamylaspartylaspartylglycylglycylser…
ltyrosylvalylisoleucylglutamyllysylarg…
inylalanyltryptophylthreonylprolylvaly…
ylarginylglutaminylasparaginylalanylth…
oleucylglutaminylglycyllysylalanyltyro…
soleucylalanylalanylglutamylasparaginy…
lprolylphenylalanylvalylglutamylthreon…
leucylarginylglutamylprolylisoleucylth…
lylglutamylaspartylleucylglutamylvalyl…
raginylthreonylvalylthreonylleucylthre…
yllysyltyrosylaspartylglycylglycylsery…
nyltyrosylvalylleucylglutamylserylargi…
tamyllysylphenylalanylhistidyllysylval…
ginylleucylleucylserylarginyllysyltyro…
sylglutamylglycylaspartylthreonyltyros…
lanylvalylasparaginylisoleucylvalylgly…
phenylalanylcysteinylthreonyllysylprol…
partylglutamylleucylalanylprolylprolyl…
lphenylalanylarginylaspartyllysylleucy…
lglutamylalanylphenylalanylalanylleucy…
lycyllysylprolyllysylprolyllysylvalyls…
rtylglutamylalanylaspartylvalylleucylg…
nylhistidylisoleucyllysylthreonylthreo…
leucylglutamyllysylisoleucyllysylalany…
yllysyltyrosylcysteinylvalylvalylvalyl…
cylserylarginyllysylglycylphenylalanyl…
valylvalylaspartylhistidylprolylglycyl…
erylphenylalanylaspartylglutamylvalylt…
lvalylisoleucylseryltryptophyllysylpro…
ylglycylseryllysylisoleucylthreonylasp…
utamyllysyllysylglutamylvalylglycyllys…
rolylvalylthreonylserylalanylserylalan…
ylvalylseryllysylleucylleucylglutamylg…
henylalanylarginylisoleucylhistidylala…
glycylisoleucylserylaspartylprolylleuc…
ysylalanyllysylaspartylarginylphenylal…
lprolylaspartylglutaminylprolylisoleuc…
llysylaspartylserylalanylleucylvalylth…
lylhistidylaspartylglycylglycyllysylpr…
osylisoleucylleucylglutamyllysylarginy…
larginyltryptophylalanylarginylvalylth…
istidylprolyltyrosylthreonyllysylpheny…
ucylleucylglutamylglycylcysteinylgluta…
inylvalylserylalanylglutamylasparaginy…
ycylaspartylprolylserylprolylprolylser…
llysylaspartylprolylisoleucylalanyllys…
aginylprolylglutamylalanylisoleucylasp…
aginylserylvalylaspartylleucylthreonyl…
inylhistidylaspartylglycylglycylseryll…
leucylvalylglutamyltyrosylglutaminylly…
myltryptophylarginylarginylalanylaspar…
lserylcysteinylprolylglutamylthreonyll…
leucylarginylaspartylglycylglutaminylt…
nylvalylleucylalanylvalylasparaginylal…
ylprolylalanylhistidylvalylprolylgluta…
tylarginylleucylglutamylprolylprolylgl…
alanylasparaginylmethionylalanylarginy…
llysylvalylglycylaspartylthreonylleucy…
soleucyllysylglycylvalylprolylphenylal…
hyllysyllysylglutamylaspartylarginylas…
ylarginylisoleucylaspartylvalylthreony…
lutamylisoleucylarginylasparaginylalan…
cylglycylisoleucyltyrosylserylleucylth…
lalanylglycylseryllysylthreonylvalylse…
aspartyllysylprolylglycylprolylprolyla…
rylglutamylisoleucylarginyllysylaspart…
yltryptophyllysylglutamylprolylleucyla…
ylisoleucylthreonylasparaginyltyrosylv…
rtylvalylalanylserylalanylglutaminyltr…
lthreonylseryllysyllysyllysylserylhist…
leucylasparaginylglutamylglycylasparag…
anylarginylvalylalanylalanylglutamylas…
inylglycylprolylphenylalanylvalylgluta…
yllysylalanylleucylaspartylprolylleucy…
olyllysylaspartylleucylhistidylhistidy…
eonylglutamylvalylserylleucylvalyltryp…
larginylaspartylglycylglycylserylproly…
ylvalylglutamyltyrosylglutaminylglutam…
spartyltryptophylisoleucyllysylphenyla…
raginylleucylglutamylcysteinylvalylval…
taminylglycyllysylthreonyltyrosylargin…
ylglutamylasparaginylisoleucylvalylgly…
threonylthreonylisoleucylprolylisoleuc…
yllysylleucylvalylprolylprolylserylval…
eucylisoleucylglutamylglycylleucylvaly…
onylvalylarginylphenylalanylprolylalan…
lylprolylvalylprolylthreonylalanyllysy…
glycylserylglutamylisoleucyllysylthreo…
hreonylvalylglutamylthreonylaspartylas…
lleucylthreonylisoleucyllysylasparagin…
rtylthreonylglycylglutamyltyrosylgluta…
araginylalanylalanylglycylseryllysylth…
lthreonylvalylleucylaspartylvalylproly…
olylisoleucylasparaginylisoleucylleucy…
lhistidylmethionylthreonylisoleucylser…
ysylaspartylaspartylglycylglycylserylp…
ylisoleucylvalylglutamyllysylglutaminy…
ylthreonyltryptophylglycylvalylvalylse…
yllysylleucyllysylisoleucylprolylhisti…
inylglutamyltyrosylvalylphenylalanylar…
raginyllysylisoleucylglycylvalylglycyl…
onylprolylthreonylvalylalanyllysylhist…
lylserylprolylprolylglycyllysylprolylv…
hreonylglutamylasparaginylalanylalanyl…
lleucylprolyllysylserylaspartylglycylg…
ycyltyrosyltyrosylmethionylglutamylarg…
cyllysyltryptophylvalylarginylvalylasp…
lalanylaspartylleucyllysylphenylalanyl…
osylglutamylglycylasparaginylthreonylt…
lylphenylalanylalanylglutamylasparagin…
lprolylserylprolylserylserylaspartylpr…
ginylprolylisoleucyllysylprolylprolylg…
ylprolyllysylleucyllysylaspartyllysyls…
partylleucylvalyltryptophylthreonyllys…
ycylserylprolylisoleucylleucylglycylty…
taminyllysylprolylglycylthreonylalanyl…
nylisoleucylasparaginyllysylaspartylgl…
nylcysteinylalanylphenylalanylarginylv…
amylglycylasparaginylglutamyltyrosylar…
sylalanylalanylasparaginylisoleucylval…
larginylglutamylleucylalanylglutamylse…
lisoleucylleucylhistidylprolylprolylgl…
lylthreonylcysteinylarginylaspartylval…
lglycylglutaminylthreonylisoleucylargi…
llysylglycylarginylprolylglutamylproly…
lthreonyllysylglutamylglycyllysylvalyl…
nylvalylaspartylleucylisoleucylglutami…
glutamylleucylglutaminylisoleucyllysyl…
artylhistidylglycyllysyltyrosylisoleuc…
nylserylserylglycylhistidylalanylgluta…
lasparaginylvalylleucylaspartylarginyl…
ylasparaginylleucyllysylvalylthreonyla…
lasparaginylcysteinylthreonylisoleucyl…
rolylleucylaspartylasparaginylglycylgl…
sparaginylphenylalanylisoleucylvalylgl…
raginylglutaminyllysylglycyltryptophyl…
tylvalylthreonyllysylarginylleucylisol…
ucylalanylasparaginylasparaginylglutam…
valylcysteinylalanylglutamylasparaginy…
hreonylisoleucylglutamylthreonyllysylt…
soleucylasparaginylprolylisoleucylaspa…
ylglutamylasparaginylleucylhistidyliso…
lthreonylphenylalanylvalyltyrosylleucy…
laspartyltyrosylaspartylglycylglycylse…
sylhistidylvalylglutamylarginylarginyl…
tyltryptophylglutamylarginylvalylhisti…
utamylthreonylhistidyltyrosylmethionyl…
lutamylasparaginylglutaminylisoleucylt…
lylglutaminylthreonyllysylasparaginylg…
artyltryptophylvalyllysylthreonylgluta…
amylaspartylleucylglutaminyllysylproly…
ylserylglycylvalylleucylthreonylvalyll…
leucylarginylleucylglutamylalanylglycy…
lalanylprolylglutamylvalylalanyltrypto…
tylalanylthreonylaspartylleucylthreony…
lisoleucylaspartylthreonylarginylalany…
lserylleucylthreonyllysylalanyllysylar…
tyrosylvalylvalylthreonylalanylthreony…
ylphenylalanylvalylalanyltyrosylalanyl…
aspartyllysylprolylglycylprolylvalylar…
lvalylaspartylvalylserylserylaspartyla…
yltryptophylaspartylprolylprolylglutam…
inylglutamylisoleucylglutaminylasparag…
ysylcysteinylglutamylthreonyllysylargi…
eonyltyrosylserylalanylthreonylvalylle…
eonylvalylthreonylarginylleucylisoleuc…
tyrosylisoleucylphenylalanylarginylval…
ysylisoleucylglycylthreonylglycylproly…
olylvalylisoleucylalanyllysylthreonyll…
larginylprolylaspartylprolylprolylglut…
ylglutamylglutamylmethionylthreonylval…
rolylglutamyltyrosylaspartylglycylglyc…
tyrosylphenylalanylleucylglutamyllysyl…
onylarginyltryptophylvalylprolylvalyla…
prolylglutamylarginylarginylmethionyll…
lleucylprolylaspartylhistidylglutamylt…
valyllysylalanylglutamylasparaginylglu…
glutamylprolylserylleucylprolylserylar…
artylprolylisoleucylglutamylprolylprol…
inylphenylalanylarginylvalylvalylaspar…
ylisoleucylthreonylleucylglycyltryptop…
artylglycylglycylalanylprolylisoleucyl…
tamylmethionylarginylprolyllysylisoleu…
spartylglutamylglycyltryptophyllysylar…
ylalanylglutaminylleucylvalylarginylly…
lthreonylserylleucylaspartylglutamylas…
lutamylphenylalanylarginylvalylcystein…
inylvalylglycylisoleucylglycylarginylp…
mylalanylisoleucyllysylprolyllysylglut…
olylglutamylisoleucylaspartylleucylasp…
ylleucylvalylisoleucylvalylarginylalan…
inylleucylphenylalanylalanylisoleucylv…
lprolyllysylvalylthreonyltryptophylarg…
ylasparaginylvalylvalylarginyllysylgly…
ylaspartylthreonylmethionylalanylpheny…
paraginylserylthreonylarginylaspartyla…
leucylthreonylleucylvalylasparaginylpr…
valylphenylalanylvalylasparaginylvalyl…
rolylglycylprolylvalylserylaspartylleu…
onyllysylthreonylserylcysteinylhistidy…
olylglutamylasparaginylaspartylglycylg…
stidyltyrosylisoleucylvalylglutamyllys…
nyllysylthreonyltryptophylserylthreony…
syllysylthreonylserylphenylalanylhisti…
lylprolylglycylasparaginylglutamyltyro…
hreonylalanylvalylasparaginylglutamylt…
threonylaspartylvalylprolyllysylprolyl…
lleucylserylglutamylprolylaspartylprol…
lanylthreonylglutamylmethionylthreonyl…
leucylalanyltryptophylleucylprolylprol…
alanyllysylisoleucylaspartylglycyltyro…
ginylglutamylglutamylglutamylglutaminy…
hylthreonylglutamyltyrosylserylvalylva…
lylvalylthreonylglycylleucyllysylgluta…
ylalanylarginylvalylalanylalanylarginy…
erylleucylprolylarginylglutamylalanylg…
anyllysylglutamylglutaminylleucylleucy…
thionylprolylglutamylglutaminylisoleuc…
llysyllysylleucylarginylisoleucylgluta…
lysylprolylhistidylprolylthreonylcyste…
glutamylaspartylglutamylvalylvalylthre…
alylhistidyllysylalanylaspartylserylse…
leucyllysylaspartylvalylthreonylarginy…
osylserylleucylthreonylalanylglutamyla…
spartylthreonylglutaminyllysylisoleucy…
tylalanylprolylglycylprolylprolylgluta…
ylisoleucylserylaspartylisoleucylaspar…
ylleucylseryltryptophylhistidylisoleuc…
lglycylserylasparaginylisoleucylthreon…
lutamyllysylcysteinylaspartylvalylsery…
ylthreonylalanylleucylalanylserylvalyl…
arginylvalylglycyllysylleucylisoleucyl…
ylisoleucylphenylalanylarginylvalylarg…
lphenylalanylglycylisoleucylserylgluta…
ysylmethionylvalylalanylglutaminylphen…
ylprolylserylglutamylprolyllysylaspara…
lvalylasparaginyllysylaspartylcysteiny…
yptophylaspartylarginylprolylaspartyls…
isoleucylisoleucylglycyltyrosylleucyli…
larginylasparaginylserylleucylleucyltr…
aspartylthreonylleucylvalylarginylsery…
inylalanylglycylleucylvalylglutamylgly…
alanylarginylisoleucyltyrosylalanylleu…
lserylprolylprolylseryllysylprolylthre…
nylarginylmethionylprolylvalylaspartyl…
ylvalylisoleucylaspartylvalylthreonyll…
oleucyltryptophylalanylarginylprolylly…
llysylisoleucylisoleucylglycyltyrosylp…
inyllysylleucylprolylglycylaspartyllys…
paraginylthreonylalanylprolylhistidylg…
lutamylglutamyltyrosylthreonylalanylth…
ysylalanylglutaminyltyrosylglutaminylp…
anylarginylthreonylalanylvalylasparagi…
lutamylprolylserylaspartylprolylvalylt…
lasparaginylvalylprolylprolylarginylis…
ylmethionyllysylserylleucylleucylthreo…
paraginylvalylcysteinylleucylaspartyla…
llysylprolylmethionylprolylthreonylval…
glycylthreonylleucylleucyllysylprolyla…
thionylalanylmethionylglutaminylarginy…
leucylglutamylleucylphenylalanylserylv…
serylglycylaspartyltyrosylthreonylisol…
nylserylserylglycylseryllysylserylalan…
valylleucylaspartyllysylprolylglycylpr…
eucylasparaginyllysylmethionyltyrosyls…
eucylseryltryptophylglutamylprolylprol…
lserylglutamylisoleucylthreonylasparag…
sylarginylglutamylthreonylserylarginyl…
utaminylvalylserylalanylthreonylvalylp…
lserylvalylglutamyllysylleucylisoleucy…
sylglutaminylphenylalanylarginylisoleu…
yllysyltyrosylglycylvalylglycylasparty…
tamylprolylalanylisoleucylalanyllysyla…
ylprolylglycylarginylcysteinylaspartyl…
raginylisoleucylthreonyllysylaspartylh…
ryptophyllysylprolylprolylalanylaspart…
oleucylthreonylglycyltyrosylleucylleuc…
nylglutaminylalanylvalylasparaginyltry…
larginyllysylprolylisoleucylisoleucylg…
anylthreonylglycylleucylglutaminylglut…
utamylphenylalanylarginylvalylthreonyl…
ylglycylprolylglycyllysylprolylserylas…
yrosylalanylarginylaspartylprolylgluta…
lprolylalanylphenylalanylprolyllysylva…
rginylserylserylvalylserylleucylserylt…
osylaspartylglycylglycylserylprolyliso…
alylglutamylvalyllysylarginylalanylasp…
phylvalylarginylcysteinylasparaginylle…
ylglutaminyllysylthreonylarginylphenyl…
ucylmethionylglutamylaspartylthreonylg…
nylarginylvalyltyrosylalanylvalylaspar…
rylaspartylprolylserylaspartylvalylpro…
yllysylaspartylisoleucylleucylisoleucy…
histidylaspartylalanylaspartylleucylar…
ucylarginylalanylglycylvalylthreonylme…
lylvalyllysylglycylarginylprolylprolyl…
hylseryllysylprolylasparaginylvalylasp…
lisoleucylglycylleucylaspartylisoleucy…
anylaspartylthreonylphenylalanylleucyl…
valylasparaginyllysyltyrosylaspartylal…
ylthreonylleucylglutamylasparaginylser…
tyrosylthreonylisoleucylvalylvalyllysy…
lycylprolylprolylisoleucylasparaginylv…
ucylseryllysylaspartylserylalanyltyros…
olylprolylisoleucylisoleucylaspartylgl…
ucylasparaginyltyrosylvalylvalylglutam…
mylarginyllysylseryltryptophylserylthr…
ysteinylseryllysylthreonylserylphenyla…
eucylglutamylglutamylglycyllysylserylt…
ylvalylphenylalanylalanylglutamylaspar…
lglycylaspartylprolylglycylglutamylthr…
lalanylserylglutaminylthreonylprolylgl…
ysylvalylarginylserylvalylseryllysylse…
yltryptophyllysyllysylprolylhistidylse…
isoleucylisoleucylglycyltyrosylvalylva…
ylglutamylglutamylasparaginyllysyltryp…
yllysylserylleucylserylleucylglutaminy…
cylthreonylglutamylglycyllysylglutamyl…
alylserylalanylglutamylasparaginylglut…
threonylprolylserylglutamylisoleucylth…
ylaspartylvalylvalylalanylprolylaspart…
ucylprolylaspartylleucylcysteinyltyros…
nylserylasparaginylphenylalanylarginyl…
lysylglycyllysylprolylalanylprolylsery…
ylglutamylaspartylprolylleucylalanylth…
erylvalylglutamylserylserylalanylvalyl…
oleucylvalyltyrosylaspartylcysteinylgl…
cyllysyltyrosylthreonylisoleucylthreon…
glycylthreonyllysylglutamylglycylthreo…
lvalylglycyllysylprolylglycylisoleucyl…
lysylphenylalanylaspartylglutamylvalyl…
ylthreonylleucyllysyltryptophylalanylp…
cylglycylserylglutamylisoleucylthreony…
lutamyllysylarginylaspartylserylvalyla…
lvalylthreonylcysteinylalanylserylalan…
nylphenylalanylarginylvalylthreonylarg…
hionylglutamyltyrosylthreonylphenylala…
sparaginyllysyltyrosylglycylvalylglycy…
amylprolylisoleucylvalylalanylarginylh…
lylprolylaspartylalanylprolylprolylpro…
spartylvalylarginylhistidylaspartylser…
lthreonylaspartylprolyllysyllysylthreo…
threonylglycyltyrosylhistidylleucylglu…
ylasparaginylserylleucylleucyltryptoph…
lthreonylprolylisoleucylarginylmethion…
alylthreonylglycylleucylthreonylglutam…
ylphenylalanylarginylvalylmethionylala…
glycylvalylglycyllysylprolylserylleucy…
lalanylleucylaspartylprolylisoleucylas…
glutamylvalylisoleucylasparaginylisole…
valylthreonylleucylisoleucyltryptophyl…
spartylglycylglycylhistidyllysylleucyl…
glutamyllysylarginylaspartylleucylprol…
llysylalanylasparaginylhistidylvalylas…
ylalanylphenylalanylthreonylvalylthreo…
lglycyllysyltyrosylglutamylphenylalany…
asparaginylthreonylalanylglycylalanyli…
mylserylthreonylglutamylthreonylisoleu…
lutamyltyrosylglutamylalanylprolylthre…
lylthreonylisoleucyllysylaspartylglycy…
glycylaspartylthreonylisoleucylvalylle…
isoleucylleucylglycyllysylprolylleucyl…
llysylalanylglycyllysylaspartylisoleuc…
ylthreonylglutaminylisoleucylthreonyls…
lmethionylleucylthreonylisoleucyllysyl…
partylalanylglycylglutamyltyrosylthreo…
sparaginylprolylphenylalanylglycylthre…
lysylvalylthreonylvalylleucylaspartylv…
rolylvalylglutamylisoleucylserylaspara…
lanylthreonylleucylthreonyltryptophylt…
partylglycylglycylserylprolylisoleucyl…
tamyllysylarginylglutamylthreonylseryl…
ylvalylvalylserylglutamylaspartylisole…
histidylvalylalanylthreonyllysylleucyl…
lglutamyltyrosylisoleucylphenylalanyla…
nylhistidyltyrosylglycyllysylglycylglu…
amylprolylvalyllysylmethionylvalylaspa…
prolylglycylprolylprolylglutamyllysylp…
alylthreonyllysylasparaginylthreonylal…
ylarginylprolylvalylaspartylaspartylgl…
eonylglycyltyrosylhistidylvalylglutamy…
rylleucylarginyltryptophylvalylarginyl…
alylserylaspartylleucylarginylcysteiny…
aminylglutamylglycylserylthreonyltyros…
erylalanylglutamylasparaginylarginylal…
ylserylglutamylalanylserylaspartylsery…
lanylalanyltyrosylprolylprolylglycylpr…
tidylvalylthreonylaspartylthreonylthre…
lalanyltryptophylglycyllysylprolylhist…
ylglutamylisoleucylthreonylglycyltyros…
nyllysylvalylglycylaspartylglutamylala…
threonylthreonylglycylthreonylalanylle…
nylphenylalanylvalylvalylprolylasparty…
myllysyltyrosylasparaginylphenylalanyl…
lasparaginylaspartylalanylglycylvalylg…
ucylprolylaspartylvalylglutamylisoleuc…
onylalanylprolylaspartylphenylalanylgl…
eucylarginylarginylthreonylleucylvalyl…
isoleucylarginylisoleucylphenylalanylv…
ylprolylalanylprolylglutamylvalylthreo…
sparaginylisoleucylasparaginylleucylly…
nylisoleucylglutamylasparaginylthreony…
eucylleucylisoleucylisoleucylprolylglu…
osylaspartylthreonylglycyllysylphenyla…
lglutamylasparaginylprolylalanylglycyl…
lylasparaginylvalylarginylvalylleucyla…
lylleucylasparaginylleucylarginylproly…
ysylaspartylserylvalylthreonylleucylhi…
lleucylisoleucylaspartylglycylglycylse…
nyltyrosylisoleucylvalylglutamyllysyla…
lysylseryltyrosylserylthreonylalanylth…
llysylcysteinylthreonyltyrosyllysylval…
glycylcysteinylglutamyltyrosylphenylal…
ylalanylglutamylasparaginylglutamyltyr…
olylthreonylglutamylthreonylthreonylgl…
utamylalanylprolylserylprolylprolylasp…
lmethionylaspartylisoleucylthreonyllys…
yltryptophylprolyllysylprolyllysylhist…
soleucylthreonylglycyltyrosylvalylisol…
llysylglycylserylaspartylglutaminyltry…
eonylthreonylvalyllysylglycylleucylglu…
raginylleucylthreonylglutamylglycylglu…
lanylglutaminylvalylmethionylalanylval…
ylserylalanylprolylarginylglutamylsery…
sylglutamylglutaminylthreonylmethionyl…
eucylarginylglycylisoleucyltyrosylglut…
yllysylalanylglycylaspartylasparaginyl…
lprolylvalylleucylglycylarginylprolyll…
tophyllysyllysylglycylaspartylglutamin…
eonylglutaminylarginylvalylasparaginyl…
lalanylthreonylserylthreonylisoleucyll…
lglutamylcysteinylvalylarginylserylasp…
leucylthreonylalanylarginylasparaginyl…
ycylaspartylvalylisoleucylthreonylisol…
lisoleucylprolylglycylprolylprolylthre…
lalanylaspartylglutamylvalylserylseryl…
enylalanylseryltryptophylaspartylproly…
lycylglycylvalylprolylisoleucylserylas…
ethionylarginylglutaminylthreonylaspar…
alylglutamylleucylalanylthreonylthreon…
onyltyrosyllysylalanylthreonylarginyll…
utamyltyrosylglutaminylphenylalanylarg…
aginylarginyltyrosylglycylvalylglycylp…
anyltryptophylisoleucylvalylalanylaspa…
ylvalylprolylglycylprolylprolylglycylt…
lalanylvalylthreonyllysylaspartylseryl…
tophylhistidylglutamylprolylleucylsery…
leucylleucylglycyltyrosylhistidylvalyl…
asparaginylglycylisoleucylleucyltrypto…
ylalanylleucylvalylprolylglycylasparag…
serylglycylleucylthreonylaspartylglycy…
ylalanylarginylvalylisoleucylalanylglu…
yllysylseryllysylprolylseryllysylproly…
alanylleucylaspartylprolylisoleucylasp…
alylprolylleucylasparaginylisoleucylth…
hreonylleucyllysyltryptophylalanyllysy…
lglycylphenylalanyllysylisoleucylthreo…
yllysylarginylaspartylleucylprolylaspa…
llysylalanylasparaginylphenylalanylser…
lasparaginylglutamylphenylalanylthreon…
tamylaspartylalanylalanyltyrosylglutam…
alanyllysylasparaginylalanylalanylglyc…
erylglutamylprolylserylaspartylalanyli…
artylaspartylvalylglutamylalanylprolyl…
yllysylphenylalanyllysylaspartylthreon…
ycylglutamylalanylphenylalanylarginyll…
ylglycylarginylprolylprolylprolylthreo…
lysylaspartylglycyllysylglutamylleucyl…
ucylglutamylisoleucyllysylisoleucylala…
lasparaginylleucylvalylasparaginyllysy…
laspartylserylglycylalanyltyrosylthreo…
raginylprolylglycylglycylphenylalanyla…
anylasparaginylvalyllysylvalylleucylas…
ylglutamylglycylprolylleucylalanylvaly…
glutamyllysylcysteinylvalylleucylseryl…
eucylaspartylaspartylglycylglycylalany…
sylisoleucylvalylglutaminyllysylarginy…
alanyltryptophylthreonylasparaginylval…
lvalylthreonyllysylleucyllysylvalylthr…
paraginylglutamyltyrosylisoleucylpheny…
alylasparaginyllysyltyrosylglycylvalyl…
erylglutamylprolylvalylleucylalanylval…
lylprolylaspartylprolylprolyllysylaspa…
hreonylisoleucylthreonyllysylaspartyls…
ptophylglycylhistidylprolylaspartylser…
isoleucylisoleucylasparaginyltyrosylis…
spartyllysylalanylglycylglutaminylargi…
lasparaginyllysyllysylthreonylleucylth…
ysylvalylserylglycylleucylthreonylglut…
utamylphenylalanylarginylisoleucylmeth…
lalanylglycylisoleucylserylalanylproly…
ylalanyltyrosyllysylalanylcysteinylasp…
prolylglycylprolylprolylglycylasparagi…
threonylserylarginylserylserylisoleucy…
raginyllysylprolylisoleucyltyrosylaspa…
cylthreonylglycyltyrosylmethionylvalyl…
glutamylglutamylaspartylglutamyltrypto…
lprolylprolylalanylglycylleucyllysylal…
leucylthreonylglycylleucylthreonylglut…
rosyllysylisoleucylarginylisoleucyltyr…
glutamylglycylleucylglycylglutamylprol…
onylprolyllysylalanylglutamylaspartyla…
utamylisoleucylglutamylleucylaspartyla…
lvalylthreonylisoleucylarginylalanylcy…
ylleucylphenylalanylvalylprolylisoleuc…
rolylglutamylvalyllysyltryptophylalany…
mylserylleucylaspartyllysylalanylseryl…
ryltyrosylthreonylleucylleucylisoleucy…
inylarginylphenylalanylaspartylserylgl…
onylvalylglutamylasparaginylserylseryl…
anylvalylasparaginylvalylarginylvalyll…
olylprolylglutaminylaspartylleucyllysy…
ylthreonylserylvalylthreonylleucylthre…
eucylleucylaspartylglycylglycylserylly…
isoleucylvalylglutamyllysylarginylglut…
tyrosylserylthreonylvalylalanylthreony…
hreonylseryltryptophyllysylvalylaspart…
lglycylcysteinylseryltyrosyltyrosylphe…
utamylasparaginylglutamyltyrosylglycyl…
utamylthreonylalanylglutamylserylvalyl…
ylleucylprolylprolylglycyllysylisoleuc…
lylthreonylarginylasparaginylserylvaly…
lysylprolylglutamylhistidylaspartylgly…
lglycyltyrosylisoleucylvalylglutamylme…
lserylaspartyllysyltryptophylalanylthr…
sylvalylthreonylglutamylalanylthreonyl…
cylglutaminylglycylglutamylglutamyltyr…
rylalanylglutaminylasparaginylglutamyl…
olylarginylglutaminylleucylserylvalylp…
tylleucylvalylisoleucylprolylprolylala…
nylalanylasparaginylthreonylphenylalan…
utamylaspartylleucyllysylvalylaspartyl…
cylarginylprolylthreonylprolylalanylva…
spartylasparaginylvalylprolylleucyllys…
valylasparaginylalanylglutamylserylthr…
serylleucylleucylthreonylisoleucyllysy…
amylaspartylvalylglycylhistidyltyrosyl…
ginylserylalanylglycylglutamylalanylis…
ginylvalylisoleucylvalylleucylaspartyl…
ylglycylprolylvalyllysylmethionylaspar…
tylserylisoleucylthreonylleucylseryltr…
sylaspartylglycylglycylserylserylisole…
oleucylvalylglutamyllysylarginylaspart…
onyltryptophylglutaminylisoleucylvalyl…
ylthreonylthreonylisoleucyllysylalanyl…
glycylcysteinylglutamyltyrosylglutamin…
lalanylglutamylasparaginylarginyltyros…
ucylasparaginylserylglutamylprolylthre…
lylphenylalanyllysylvalylprolylglycylp…
lvalylthreonylleucylserylserylarginyla…
lutaminyltryptophylasparaginylglutamyl…
lycylserylarginylvalylisoleucylglycylt…
lysylglutamylarginylasparaginylserylis…
ucylasparaginyllysylthreonylprolylisol…
henylalanyllysylthreonylthreonylglycyl…
utamyltyrosylglutamylphenylalanylargin…
ylisoleucylvalylglycylisoleucylglycyll…
mylcysteinyltyrosylvalylalanylarginyla…
lprolylglycylarginylprolylglutamylalan…
ginylasparaginylserylvalylthreonylleuc…
lylthreonyltyrosylaspartylglycylglycyl…
rosylisoleucylvalylglutamyllysyllysylg…
ginyltryptophylmethionyllysylalanylser…
oleucylisoleucylaspartylthreonylhistid…
glycylleucylvalylglutamylaspartylhisti…
ylarginylvalylisoleucylalanylarginylas…
nylalanylserylglutamylprolylserylgluta…
ylthreonylalanylarginylaspartylglutamy…
oleucylserylmethionylaspartylprolyllys…
ucylvalylvalylhistidylalanylglycylglut…
rtylalanylaspartylisoleucyltyrosylglyc…
lisoleucylglutaminyltryptophylisoleucy…
mylleucylserylasparaginylthreonylalany…
lserylthreonylaspartylphenylalanylalan…
laspartylalanylvalylarginylvalylaspart…
eucylleucyllysylalanyllysylasparaginyl…
ylvalylthreonylvalylasparaginylvalylly…
glycylprolylprolylglutamylglycylprolyl…
threonylalanylglutamyllysylcysteinylth…
olylprolylleucylglutaminylaspartylglyc…
ucylasparaginyltyrosylisoleucylvalylgl…
lserylarginylleucylvalyltryptophylthre…
inylvalylglutaminylthreonylleucylseryl…
cylleucylglutamylglycylasparaginylglut…
nylisoleucylmethionylalanylvalylaspara…
lutamylprolylleucylglutamylserylglutam…
ginylprolylphenylalanylvalylvalylproly…
lylglutamylvalylthreonylthreonylvalylt…
soleucylvalylvalyltryptophylglutamylar…
lglycylserylglutamylisoleucylleucylgly…
rginylaspartyllysylglutamylglycylisole…
lcysteinylhistidyllysylarginylleucylis…
eucylarginylvalylthreonylglycylleucyli…
aspartyltyrosylglutamylphenylalanylarg…
inylalanylalanylglycylleucylserylgluta…
yltyrosylglutaminyllysylalanylcysteiny…
lprolylglycylprolylprolylasparaginylas…
spartylisoleucylthreonylarginylserylse…
tophylseryllysylprolylisoleucyltyrosyl…
ylisoleucylglutaminylglycyltyrosylisol…
artylvalylasparaginylvalylglycylglutam…
nylthreonylprolylprolylthreonylglycyli…
araginylisoleucylglutamylvalylglutamyl…
dylglutamyltyrosylasparaginylphenylala…
soleucylasparaginyllysylalanylglycylva…
rtylvalylprolylglycylprolylisoleucylis…
ucylglutamylalanylprolylaspartylisoleu…
amylleucylarginyllysylisoleucylisoleuc…
glycylglycylserylleucylarginylleucylph…
glycylarginylprolylthreonylprolylgluta…
alylaspartylglycylglutamylisoleucylarg…
oleucylaspartylvalylthreonylserylseryl…
lleucylaspartylasparaginylvalylasparag…
yllysyltyrosylthreonylleucylthreonylle…
ycylthreonyllysylserylalanylphenylalan…
cylaspartylthreonylprolylserylprolylpr…
lthreonylglutamylisoleucylthreonyllysy…
reonyltryptophylglutamylprolylprolylle…
lysylisoleucyllysylasparaginyltyrosyli…
utamylalanylthreonylarginyllysylserylt…
lasparaginylcysteinylhistidyllysylaspa…
laspartylglutaminylleucylglutaminylglu…
osylphenylalanylarginylvalylthreonylal…
sylglycylisoleucylglycylleucylprolylal…
lprolylisoleucyllysylvalylalanylglutam…
glycyllysylisoleucylthreonylvalylaspar…
raginylserylvalylserylleucylseryltrypt…
tidylaspartylglycylglycylseryllysyliso…
leucylvalylglutamylmethionylglutaminyl…
yltryptophylserylglutamylcysteinylalan…
minylalanylvalylisoleucylthreonylaspar…
lglutamylglutamyltyrosylleucylphenylal…
araginylglutamyllysylglycylarginylsery…
anylvalylprolylisoleucylvalylalanyllys…
mylprolylaspartylvalyllysylprolylalany…
valylglutaminylvalylglycylglutaminylas…
alylprolylisoleucylserylglycylarginylp…
reonyltryptophylthreonyllysylaspartylg…
nylthreonylthreonylarginylisoleucylasp…
eucylaspartylleucylthreonylthreonylleu…
nylhistidyllysylaspartylaspartylglycyl…
cylthreonylvalylalanylasparaginylvalyl…
lanylserylisoleucylglutamylisoleucylva…
laspartylprolylprolyllysylglycylprolyl…
tylvalylserylalanylglutamylserylisoleu…
araginylprolylprolylleucyltyrosylthreo…
soleucylthreonylasparaginyltyrosylisol…
artylthreonylthreonylthreonylthreonylv…
ylalanylthreonylvalylalanylarginylthre…
llysylleucyllysylthreonylglycylthreony…
nylarginylisoleucylphenylalanylalanylg…
cylglutaminylserylphenylalanylalanylle…
eucylvalylalanylglutaminyltyrosylproly…
olylprolylglycylthreonylprolylphenylal…
ryllysylaspartylserylmethionylvalyliso…
lutamylprolylvalylasparaginylasparagin…
ucylglycyltyrosylhistidylleucylglutamy…
inylserylisoleucylleucyltryptophylthre…
nylisoleucylisoleucylhistidylaspartylt…
lanylglutaminylasparaginylleucylglutam…
rosylglutamylphenylalanylarginylvalylt…
eucylvalylglycylvalylglycyllysylalanyl…
ysteinyltyrosylvalylalanylarginylaspar…
lylglycylthreonylprolylglutamylprolyli…
sparaginylglutamylisoleucylthreonylleu…
lprolylvalyltyrosylaspartylglycylglycy…
cyltyrosylisoleucylvalylglutamyllysyla…
lycylarginyltryptophylmethionyllysylal…
ginylvalylisoleucylglutamylthreonylglu…
ylglycylleucylthreonylglutamylaspartyl…
nylalanylarginylvalylisoleucylalanylly…
nylisoleucylseryllysylprolylserylaspar…
ylthreonylalanyllysylaspartylglutamylv…
eucylserylmethionylaspartylprolyllysyl…
isoleucylvalylvalylasparaginylalanylgl…
inylleucylglutamylalanylaspartylvalylh…
lthreonylisoleucylglutamyltryptophylle…
mylisoleucylglutamylglutamylserylalany…
ysylasparaginylthreonylaspartylphenyla…
ylvalyllysylaspartylalanylisoleucylarg…
utaminyltyrosylisoleucylleucylarginyla…
cylseryllysylserylphenylalanylprolylva…
aspartylarginylprolylglycylprolylproly…
lvalylthreonylglycylvalylthreonylseryl…
reonyltryptophylserylprolylprolylleucy…
laspartylisoleucylserylhistidyltyrosyl…
mylthreonylserylarginylleucylalanyltry…
lglutamylvalylvalylthreonylasparaginyl…
eucylleucylglutamylglycylasparaginylgl…
ylisoleucylmethionylalanylvalylasparag…
utamylprolylleucylglutamylserylalanylp…
aginylprolylphenylalanylvalylleucylpro…
ylglutamylvalylthreonylasparaginylisol…
nylthreonylvalylcysteinyltryptophylasp…
spartylglycylglycylserylglutamylisoleu…
alylglutamyllysylarginylaspartylarginy…
hylisoleucyllysylcysteinylasparaginyll…
aspartylleucylarginylleucylarginylvaly…
ylaspartylhistidylglutamyltyrosylgluta…
nylglutamylasparaginylalanylalanylglyc…
lylalanylthreonylvalyltyrosyltyrosylly…
ylphenylalanyllysylprolylglycylprolylp…
dylisoleucylvalylaspartylthreonylthreo…
reonylleucylalanyltryptophylglycyllysy…
ylglycylserylglutamylisoleucylleucylgl…
cylcysteinyllysylalanylaspartylglutamy…
ylisoleucylvalylthreonylprolylglutamin…
hreonylarginylphenylalanylglutamylisol…
ylhistidylglutaminylglutamyltyrosyllys…
nylleucylasparaginyllysylvalylglycylle…
ylvalylprolylglycylthreonylvalyllysylp…
tamylalanylprolylglutamylleucylasparty…
rginyllysylglycylisoleucylvalylvalylar…
rginylisoleucylhistidylisoleucylprolyl…
lmethionylprolylglutamylisoleucylthreo…
utamylglycylglutamylphenylalanylthreon…
ucylglutamyllysylglycylvalylasparaginy…
ylisoleucylaspartylasparaginylcysteiny…
alanylglycyllysyltyrosylisoleucylleucy…
lserylglycylseryllysylserylalanylpheny…
leucylaspartylthreonylprolylglycylprol…
alanylvalyllysylglutamylvalylarginylly…
eucylvalyltryptophylglutamylprolylprol…
lycylalanyllysylvalyllysylasparaginylt…
ginylglutamylserylthreonylarginyllysyl…
serylseryllysylcysteinylseryllysylthre…
amylasparaginylleucylthreonylglutamylg…
henylalanylarginylvalylmethionylalanyl…
anylglycylvalylglycylvalylprolylvalylg…
alyllysylalanylalanylglutamylprolylpro…
lthreonylleucylthreonylaspartylvalylse…
ylleucylmethionyltryptophylglutamyllys…
cylglycylserylarginylvalylleucylglycyl…
lutaminylprolyllysylglycylthreonylglut…
lylalanylglutamylseryllysylvalylcystei…
nylglycylleucylserylserylglycylglutami…
lanylarginylvalyllysylalanyltyrosylasp…
ylaspartylprolylarginylvalylleucylglyc…
sylaspartylleucylthreonylisoleucylglut…
rolylphenylalanylasparaginylthreonylty…
glycylglutamylaspartylleucyllysylisole…
leucylglycylarginylprolylarginylprolyl…
valyllysylaspartylglycylglutamylprolyl…
ylarginylvalylasparaginylvalylglutamyl…
threonylvalylleucylhistidylisoleucylly…
partylaspartylphenylalanylglycyllysylt…
reonylasparaginylserylalanylglycylthre…
ylleucylserylvalylisoleucylvalylleucyl…
ylvalylglycylprolylvalylarginylphenyla…
ylaspartylphenylalanylvalylvalylisoleu…
lylalanyltyrosylthreonylglycylglycylcy…
raginyltyrosylisoleucylvalylglutamylly…
hreonylthreonylthreonyltryptophylhisti…
lvalylalanylarginylthreonylthreonyliso…
ucyllysylthreonylglycylthreonylglutamy…
ylisoleucylphenylalanylalanylglutamyla…
serylalanylprolylleucylaspartylserylly…
nyltyrosylprolylphenylalanyllysylgluta…
reonylprolylphenylalanylvalylthreonyls…
aminylmethionylleucylvalylglutaminyltr…
asparaginylaspartylglycylglycylthreony…
ylhistidylleucylglutamylglutaminyllysy…
ucylleucyltryptophylvalyllysylleucylas…
ylglutaminylaspartylthreonyllysylpheny…
eucylaspartylglutamylglycylleucylgluta…
valylserylalanylglutamylasparaginyliso…
ylprolylseryllysylvalylserylglutamylcy…
ylaspartylprolylcysteinylaspartylproly…
lanylisoleucylvalylisoleucylthreonylar…
eonylleucyllysyltryptophyllysyllysylpr…
ylseryllysylisoleucylthreonylglycyltyr…
laspartylleucylprolylaspartylglycylarg…
erylphenylalanylthreonylasparaginylval…
nylalanylthreonylvalylserylglycylleucy…
inyltyrosylglutamylphenylalanylarginyl…
nylalanylalanylglycylasparaginylphenyl…
tylserylserylglycylalanylisoleucylthre…
oleucylaspartylalanylprolylasparaginyl…
ltyrosyllysylaspartylvalylisoleucylval…
threonylphenylalanylvalylleucylglutamy…
yllysylprolylisoleucylprolylaspartylva…
lglycyllysylglutamylleucylglutamylglut…
ionylglutamylisoleucyllysylserylthreon…
hreonylleucylvalylvalyllysylaspartylcy…
rtylglycylglycylglutaminyltyrosylisole…
ylvalylglycylglycylthreonyllysylseryli…
llysylvalylleucylaspartylarginylprolyl…
ylleucyllysylvalylthreonylglycylvalylt…
tyrosylleucylalanyltryptophylasparagin…
tylglycylglycylalanylasparaginylisoleu…
leucylglutamyllysylarginylglutamylthre…
ylthreonylglutaminylvalylserylthreonyl…
asparaginyltyrosyllysylvalylthreonylly…
nylglutamyltyrosylisoleucylphenylalany…
paraginyllysyltyrosylglycylisoleucylgl…
ylglycylprolylvalylthreonylalanylcyste…
olylprolylglycylprolylprolylserylthreo…
oleucylthreonyllysylaspartylserylmethi…
nylarginylprolylvalylaspartylaspartylg…
lglutamylglycyltyrosylisoleucylleucylg…
tamylglycylvalylarginyltryptophylthreo…
sylthreonylleucylthreonylaspartylleucy…
lycylleucylthreonylglutamylglycylhisti…
arginylvalylalanylalanylglutamylaspara…
lutamylprolylserylglutamylprolylserylv…
lcysteinylaspartylalanylleucyltyrosylp…
sparaginylprolyllysylvalylthreonylaspa…
alylserylleucylalanyltryptophylserylly…
ycylglycylalanylprolylvalyllysylglycyl…
glutamylalanylalanylalanylaspartylglut…
inylthreonylprolylprolylthreonylglycyl…
ylphenylalanylthreonylvalylthreonyllys…
eonylglutamyltyrosylasparaginylphenyla…
lisoleucylasparaginylserylglutamylglyc…
reonylleucylprolylglycylserylvalylvaly…
leucylglutamylprolylprolylglutamylisol…
partylleucylarginyllysylvalylvalylvaly…
onylleucylarginylleucylphenylalanylval…
ylprolylglutamylprolylglutamylvalyllys…
amylglycylisoleucylleucylthreonylaspar…
glutamylvalylthreonylserylserylphenyla…
oleucylaspartylasparaginylvalylthreony…
ycylarginyltyrosylasparaginylleucylthr…
aginylserylglycylseryllysylthreonylala…
larginylvalylleucylaspartylserylprolyl…
ucylthreonylisoleucylarginylglutamylva…
onylleucylseryltryptophylglutamylproly…
lglycylalanyllysylisoleucylthreonylasp…
yllysylarginylglutamylthreonylthreonyl…
onylisoleucylthreonylasparaginylaspara…
threonylphenylalanylarginylisoleucylgl…
utamylglycylcysteinylseryltyrosyltyros…
nylserylasparaginylglutamyltyrosylglyc…
glutamylthreonylthreonylglutamylprolyl…
rolylleucylprolylprolylglycylarginylva…
threonylarginylasparaginylthreonylalan…
lutamyllysylprolylglutamylserylasparty…
eonylglycyltyrosylvalylvalylglutamylme…
lserylglutamyllysyltryptophylserylthre…
llysylthreonylleucylglutamylalanylthre…
nylalanylglycylglutamylglutamyltyrosyl…
alanylvalylasparaginylglutamyllysylgly…
lglutaminylleucylglycylvalylprolylvaly…
eucylglutamylisoleucyllysylprolylseryl…
ylhistidylthreonylphenylalanylasparagi…
lutaminylleucyllysylisoleucylaspartylv…
ginylprolylglutaminylalanylthreonylval…
aspartylglycylglutaminylthreonylleucyl…
lvalylasparaginylvalylserylserylseryll…
lserylisoleucyllysylglutamylalanylsery…
reonyltyrosylglutamylleucylcysteinylva…
lserylisoleucylthreonylvalylprolylisol…
lleucylaspartylarginylprolylglycylprol…
lisoleucylaspartylglutamylvalylserylcy…
ylisoleucylseryltryptophylasparaginylp…
lycylglycylcysteinylglutaminylisoleucy…
lylglutamyllysyllysylglutamylthreonylt…
hylhistidylisoleucylvalylserylglutamin…
erylisoleucyllysylisoleucylvalylarginy…
lutamyltyrosylglutaminylphenylalanylar…
paraginylarginyltyrosylglycyllysylsery…
lalanylvalylvalylalanylglutamyltyrosyl…
glycylprolylprolylglycylthreonylprolyl…
yllysylserylthreonylmethionylleucylval…
prolylvalylasparaginylaspartylglycylgl…
ltyrosylhistidylleucylglutamyltyrosyll…
cylleucyltryptophylseryllysylalanylasp…
ylalanylaspartylthreonylglutaminylvaly…
lglutamylglycylleucylmethionyltyrosylg…
anylglutamylasparaginylisoleucylalanyl…
seryllysylserylcysteinylglutamylprolyl…
lylcysteinylaspartylprolylprolylglycyl…
ylasparaginylisoleucylthreonylarginyll…
ophylseryllysylprolylhistidyltyrosylas…
cylthreonylglycyltyrosylisoleucylvalyl…
lprolylaspartylglycylarginyltryptophyl…
sylthreonylasparaginylisoleucylglutami…
nylglutamylvalylthreonylglutamylleucyl…
rginyltyrosylglutamylphenylalanylargin…
araginylalanylalanylaspartylserylvalyl…
ylthreonylglycylprolylisoleucylisoleuc…
utamylprolylprolylarginylvalylmethiony…
lanylarginylaspartylvalylisoleucylvaly…
lleucyllysylisoleucylasparaginylalanyl…
lprolylleucylprolylvalylisoleucylseryl…
isoleucylglutamylisoleucylglutamylglut…
tamylisoleucylisoleucylserylthreonylas…
ucylleucylthreonylvalyllysylaspartylcy…
tylthreonylglycylglutaminyltyrosylvaly…
ylvalylalanylglycylthreonylarginylsery…
yllysylvalylleucylaspartyllysylprolylg…
leucylglutamylisoleucylasparaginylglyc…
cysteinylserylleucylseryltryptophylgly…
spartylglycylglycylalanylaspartylisole…
rginyllysyllysylarginylglutamylthreony…
lthreonylisoleucylcysteinylglutamylgly…
lthreonylserylcysteinyllysylvalylthreo…
raginylglutamyltyrosylisoleucylphenyla…
lasparaginyllysyltyrosylglycylvalylgly…
lvalylalanylisoleucyllysylalanylleucyl…
alylprolylserylprolylprolylthreonylser…
rylvalylthreonyllysylglutamylserylmeth…
hylserylarginylprolylglutamylserylaspa…
cylserylglycyltyrosylisoleucylisoleucy…
lasparaginylserylleucylarginyltryptoph…
lysylprolylvalyltyrosylaspartylleucyla…
leucylarginylglutamylglycylcysteinylgl…
valyltyrosylalanylglutamylasparaginyla…
rolylserylglutamylthreonylserylprolyll…
aspartylprolylvalylphenylalanylleucylp…
lyllysylisoleucylvalylaspartylserylgly…
reonylisoleucylalanyltryptophylvalylly…
glycylglycylalanylprolylisoleucylthreo…
yltyrosyllysyllysylserylaspartylaspart…
reonylserylisoleucylglutaminylserylleu…
osylthreonylisoleucylserylglycylleucyl…
ltyrosylvalylphenylalanylarginylvalyll…
glycylalanylserylaspartylprolylserylas…
minylisoleucylalanyllysylglutamylargin…
cylphenylalanylaspartylisoleucylaspart…
lthreonylleucylisoleucylvalyllysylalan…
onylmethionylthreonylvalylprolylphenyl…
ylprolylasparaginylvalylleucyltryptoph…
spartylleucylarginylthreonylarginylala…
onylaspartylserylarginylthreonylseryll…
aginylalanylasparaginylarginylasparagi…
hreonylleucylthreonylisoleucylglutamin…
alanylserylleucylthreonylleucylvalylva…
prolylglycylprolylprolylthreonylaspara…
ylaspartylvalylthreonyllysylglutamylse…
aspartylvalylprolylglutamylasparaginyl…
yllysylasparaginyltyrosylhistidylisole…
nylseryllysyllysylalanyltryptophylvaly…
aginylcysteinylasparaginylarginylleucy…
raginylleucylglutaminylglutamylglycyla…
lanylarginylvalylserylglycylglutamylas…
valylglycylisoleucylprolylalanylglutam…
ysylisoleucylthreonylglutamyllysylprol…
cylglycylvalylthreonylserylisoleucylse…
ylthreonyltryptophylleucyllysylprolylg…
serylarginylisoleucylvalylhistidyltyro…
utamyllysylglycylglutaminyllysylaspara…
lanylvalylalanyllysylserylthreonylhist…
ucylarginylglutamylasparaginylserylglu…
larginylvalylphenylalanylalanylglutamy…
eucylserylaspartylprolylarginylglutamy…
lisoleucyllysylglutamylglutaminylleucy…
cylaspartylmethionyllysylasparaginylph…
ylvalyltyrosylvalylarginylalanylglycyl…
artylisoleucylprolylisoleucylserylglyc…
threonylleucylserylarginylaspartylglyc…
nylmethionylarginylphenylalanylasparag…
ylalanylglutamylasparaginylleucylthreo…
lutamylserylvalylthreonylalanylasparty…
isoleucylthreonylalanylalanylasparagin…
ysylalanylphenylalanylisoleucylasparag…
ylarginylprolylglycylprolylprolylthreo…
erylaspartylisoleucylthreonylglutamylg…
ltryptophylglutamylprolylprolyllysylty…
minylvalylthreonylasparaginyltyrosylis…
amylthreonylserylthreonylalanylvalyltr…
lanylthreonylvalylalanylarginylthreony…
nyllysylleucylthreonylthreonylglycylgl…
ylalanylarginylisoleucyllysylalanylglu…
glycylisoleucylserylaspartylhistidylis…
valylthreonylvalyllysylleucylprolyltyr…
lylprolylserylthreonylprolyltryptophyl…
ylarginylglutamylserylisoleucylthreony…
mylprolylvalylserylasparaginylglycylgl…
sylhistidylleucylglutamylmethionyllysy…
leucylleucyltryptophylglutaminyllysyla…
leucylarginylthreonylthreonylhistidylp…
ylisoleucylserylalanylglycylleucylisol…
inylvalyltyrosylalanylglutamylasparagi…
ylprolylserylhistidylprolylserylglutam…
spartylalanylcysteinylglutamylprolylpr…
soleucylthreonylaspartylisoleucylseryl…
ylseryltryptophylglutaminylglutaminylp…
ylglycylseryllysylisoleucylthreonylgly…
inylarginylaspartylleucylprolylasparty…
ylalanylserylphenylalanylthreonylaspar…
glutaminylphenylalanylthreonylisoleucy…
lasparaginylserylglutaminyltyrosylglut…
lanylalanylarginylasparaginylalanylval…
nylprolylserylglutamylvalylvalylglycyl…
leucylaspartylseryltyrosylglycylglycyl…
rolylleucylglutamyltyrosylthreonylglut…
anylglycylthreonylserylvalyllysylleucy…
lycyllysylprolylalanylprolylthreonylis…
ylaspartylaspartyllysylglutamylleucylg…
eucylvalylcysteinylvalylglutamylaspara…
alanylserylisoleucylleucylisoleucyllys…
ylasparaginylserylglycylcysteinyltyros…
sparaginylalanylmethionylalanylserylal…
inylvalylglutaminylisoleucylleucylaspa…
ycylglycylprolylisoleucylglutamylpheny…
anylglutamyllysylisoleucylthreonylleuc…
ylalanylaspartylaspartylglycylglycylal…
yrosylisoleucylvalylglutamyllysylargin…
valyltryptophylserylmethionylvalylsery…
amylcysteinylisoleucylisoleucylthreony…
eucyllysylglycylasparaginylglutamyltyr…
ylarginylalanylvalylasparaginyllysylty…
rolylleucylglutamylserylaspartylserylv…
ylphenylalanylvalylthreonylprolylglycy…
lutamylvalylthreonyllysylisoleucylthre…
hreonylvalylvalyltryptophylserylarginy…
lglycylserylaspartylisoleucylserylglyc…
lysylarginylaspartyllysyllysylserylleu…
lvalylleucyllysylglutamylthreonylisole…
lutaminyllysylvalylthreonylglycylleucy…
partyltyrosylglutaminyltyrosylarginylv…
alanylalanylglycylglutaminylglycylprol…
rylglutamylphenylalanyltyrosyllysylala…
artylprolylprolylglycylprolylprolylala…
anylaspartylserylthreonyllysylserylser…
tophylseryllysylprolylvalyltyrosylaspa…
eonylglycyltyrosylvalylvalylglutamylis…
mylglutamylglutamylglutamyltryptophylt…
sylglycylglutamylvalylarginylthreonylt…
ylasparaginylleucyllysylprolylglycylva…
lanylarginylvalylserylalanylvalylaspar…
ylglycylglutamylprolylisoleucylglutamy…
valylglutaminylalanyllysylaspartylisol…
amylisoleucylaspartylleucylaspartylval…
alylisoleucylalanyllysylalanylglycylgl…
eucylisoleucylprolylphenylalanyllysylg…
nylvalylthreonyltryptophylarginyllysyl…
cylglycylserylaspartylalanylarginyltyr…
ylthreonylaspartylserylserylserylleucy…
minylvalylthreonylarginylasparaginylas…
leucylleucylthreonylisoleucylglutamyla…
prolyllysylserylserylthreonylvalylsery…
nylprolylalanylalanylcysteinylglutamin…
stidylvalylserylarginylglycylthreonylv…
spartylprolylprolylleucylisoleucylaspa…
lisoleucylasparaginyltyrosylvalylisole…
nylthreonyllysylarginylthreonyltryptop…
lcysteinylserylserylthreonylserylpheny…
leucylserylglutamyllysylthreonylprolyl…
larginylvalylleucylalanylglutamylaspar…
cylglycylglutamylprolylcysteinylglutam…
yllysylalanylalanylglutamylvalylprolyl…
lleucylserylmethionyllysylaspartylsery…
leucylleucylseryltryptophylthreonyllys…
lglycylglycylserylvalylisoleucylthreon…
arginyllysylglycyllysylglycylglutamylg…
tidylalanylglycylisoleucylseryllysylth…
tamylvalylserylglutaminylleucyllysylgl…
tamylphenylalanylarginylvalylphenylala…
sylglycylleucylserylaspartylprolylvaly…
ucylthreonylvalyllysylglutamylleucylis…
mylvalylaspartylleucylserylaspartyliso…
alylthreonylvalylarginylisoleucylglycy…
ucylglutamylleucylprolyltyrosyllysylgl…
eucylseryltryptophylleucyllysylasparty…
mylserylglutamylphenylalanylvalylargin…
tamylasparaginyllysylisoleucylthreonyl…
lalanyllysyllysylglutamylhistidylglycy…
leucylleucylaspartylasparaginylalanylv…
valylprolylisoleucylthreonylvalylisole…
lseryllysylprolyllysylglycylprolylisol…
tamylisoleucyllysylalanylaspartylseryl…
aspartylvalylprolylglutamylaspartylasp…
soleucylthreonylcysteinyltyrosylseryli…
lthreonylserylglutaminylthreonylaspara…
ysteinylserylserylvalylalanylarginylth…
lprolylasparaginylleucylvalyllysylaspa…
phenylalanylarginylvalylarginylalanylg…
cylvalylserylglutaminylprolylleucylval…
alanyllysylhistidylglutaminylphenylala…
ylprolylglycyllysylprolylvalylisoleucy…
ylaspartylglycylmethionylserylleucylth…
lvalyltyrosylaspartylglycylglycylseryl…
anylhistidylvalylglutamyllysyllysylglu…
ylleucyltryptophylglutaminyllysylvalyl…
ucylserylglycylarginylglutamyltyrosyla…
ylglutamylglycylleucylaspartyltyrosylg…
rosylalanylglutamylasparaginylserylala…
laspartylprolylseryllysylphenylalanylt…
valylaspartylprolylprolylglycylthreony…
rtylvalylthreonylarginylglutamylthreon…
ophylasparaginylprolylprolylleucylargi…
oleucylvalylglycyltyrosylserylisoleucy…
ylasparaginylglutamylarginyltryptophyl…
nylalanylthreonylaspartylvalylserylglu…
onylvalylthreonylglycylleucylserylprol…
mylphenylalanylarginylisoleucylisoleuc…
ylglycylthreonylisoleucylserylprolylpr…
isoleucylisoleucylmethionylthreonylarg…
lprolylprolylisoleucylvalylglutamylphe…
lphenylalanylaspartylglycylleucylisole…
ylserylleucylarginylisoleucyllysylalan…
lprolylvalylprolylarginylvalylthreonyl…
glycylvalylglutamylisoleucylglutamylly…
onylglutamylisoleucylthreonylasparagin…
ylleucylphenylalanylvalylarginylaspart…
idylarginylglycylvalyltyrosylthreonylv…
lanylserylglycylserylalanyllysylalanyl…
ylglutaminylaspartylthreonylprolylglyc…
cylarginylphenylalanylthreonylasparagi…
ysylmethionylthreonylleucyltryptophylt…
asparaginylaspartylglycylcysteinylalan…
rosylisoleucylisoleucylglutamyllysylar…
ucylalanyltryptophylalanylleucylisoleu…
utamylalanylglutaminylseryltyrosylthre…
ucylasparaginylglycylasparaginylglutam…
nylvalylserylalanylvalylasparaginyllys…
nylprolylleucylaspartylserylaspartylpr…
ucylglutaminyltyrosylthreonylvalylprol…
ylprolylglutamylprolylserylasparaginyl…
erylisoleucylthreonylleucylthreonyltry…
erylaspartylglycylglycylserylglutamyli…
isoleucylleucylglutamylarginylarginylg…
yltryptophylvalyllysylvalylisoleucylse…
glutamylthreonylarginylphenylalanyllys…
glutamylglycylasparaginylglutamyltyros…
methionylalanylglutamylasparaginylalan…
ylserylglycylisoleucylserylarginylleuc…
tamylprolylvalylasparaginylprolylproly…
yllysylvalylthreonylaspartylthreonylse…
eucylglutamyltryptophylseryllysylproly…
cylmethionylglutamylisoleucylisoleucyl…
amylmethionylcysteinyllysylthreonylasp…
histidyllysylvalylasparaginylalanylglu…
nylarginyltyrosylthreonylvalylthreonyl…
lglutamylglutamyltyrosyllysylphenylala…
asparaginylglycylalanylglycyllysylglyc…
ylthreonylglycylthreonylisoleucyllysyl…
eonylalanylprolylglutamylleucylasparty…
phenylalanyllysylglutaminylthreonylhis…
lanylserylisoleucylarginylleucylphenyl…
nylglycylarginylprolylthreonylprolylth…
ylprolylaspartylserylasparaginylleucyl…
leucylhistidylthreonylthreonylaspartyl…
lthreonylvalylglutamylasparaginylcyste…
partylalanylglycyllysyltyrosylthreonyl…
nylasparaginylserylglycylseryllysylser…
onylvalyllysylvalylleucylaspartylthreo…
olylisoleucylthreonylphenylalanyllysyl…
erylalanylthreonylleucylmethionyltrypt…
ylaspartylglycylglycylalanylarginyliso…
alylglutamyllysylarginylglutamylalanyl…
lutaminylvalylisoleucylserylglutamylly…
ylisoleucylphenylalanyllysylvalylaspar…
lycylvalylprolyltyrosyltyrosylphenylal…
araginylglutamyltyrosylglycylvalylglyc…
ionylprolylglutamylprolylisoleucylvaly…
olylalanylprolylprolylarginylarginylle…
nylseryllysylserylserylalanylvalylleuc…
aspartylhistidylaspartylglycylglycylse…
rosylleucylleucylglutamylmethionylargi…
ylleucyltryptophylvalylglutamylalanylg…
lleucylthreonylphenylalanylthreonylval…
llysylthreonylglutamyltyrosylglutamylp…
ysylasparaginylaspartylalanylglycyltyr…
mylalanylphenylalanylserylserylvalylis…
glutaminylisoleucylglutamylprolylthreo…
ylisoleucylthreonylasparaginylglutamin…
ysylalanylglycylserylprolylphenylalany…
ylisoleucylserylglycylarginylprolylala…
yllysylleucylglutamylglutamylmethionyl…
spartylarginylvalylserylisoleucylthreo…
inylthreonylthreonylleucylthreonylvaly…
glycylaspartylserylglycylarginyltyrosy…
utamylasparaginylthreonylalanylglycylv…
alylthreonylvalylvalylvalylisoleucylgl…
hreonylglycylprolylisoleucylglutamylva…
ylserylcysteinylvalylleucylseryltrypto…
ylglycylglycylglycylthreonylglutamylis…
oleucylvalylglutamyllysylarginylglutam…
tryptophylglutaminylleucylvalylasparag…
onylglutaminylisoleucyllysylvalylthreo…
ylmethionylglutamyltyrosylserylphenyla…
asparaginylarginylphenylalanylglycylva…
rylalanylprolylisoleucylisoleucylalany…
valylprolylprolylserylalanylprolylthre…
ylhistidylvalylserylalanylasparaginyla…
tryptophylglutamylglutamylprolyltyrosy…
ysylisoleucylisoleucylglycyltyrosyltry…
mylarginylasparaginylthreonylisoleucyl…
sparaginyllysylvalylprolylcysteinylleu…
syllysylvalylthreonylglycylleucylvalyl…
glutaminylphenylalanylarginylthreonylt…
alanylglycylvalylseryllysylalanylseryl…
leucylmethionylalanylglutaminylasparag…
glycylarginylprolylglutamylvalylthreon…
threonylvalylserylleucylisoleucyltrypt…
aspartylglycylglycylseryllysylvalylval…
utamylarginyllysylprolylvalylserylglut…
ltryptophylleucyllysylcysteinylasparag…
rylaspartylasparaginylphenylalanylphen…
leucylserylglutamylglycylaspartylthreo…
ylvalylleucylalanyllysylasparaginylala…
ysylglycylserylglutamylserylthreonylgl…
inylaspartylglutamyltyrosylalanylproly…
artylalanylarginylleucylhistidylglycyl…
larginylalanylglycylserylaspartylleucy…
ylglycylglycyllysylprolylglutamylproly…
hreonyllysylglycylaspartyllysylglutamy…
myllysylvalylserylleucylglutaminyltyro…
threonylalanylvalylisoleucyllysylpheny…
laspartylserylglycyllysyltyrosylthreon…
ylalanylserylglycylthreonyllysylalanyl…
alylleucylaspartylserylprolylglycylpro…
ylvalylserylarginylvalylthreonylglutam…
eucylalanyltryptophylserylleucylprolyl…
cylalanylglutamylisoleucylthreonylhist…
ginylarginylglutamylthreonylserylargin…
soleucylvalylglutamylglycylglutamylcys…
sylvalylvalylthreonylarginylleucylisol…
tamyltyrosylisoleucylphenylalanylargin…
llysyltyrosylglycylprolylglycylvalylpr…
lisoleucylvalylalanylarginylasparaginy…
prolylserylprolylprolylglycylisoleucyl…
reonylglycyllysylglutamylhistidylisole…
ptophylthreonyllysylprolylglutamylsery…
tamylisoleucylserylasparaginyltyrosyll…
myllysylglutamylserylleucylarginyltryp…
yllysylaspartyltyrosylvalylvalyltyrosy…
valylthreonylserylleucylmethionylgluta…
utaminylphenylalanylarginylvalylthreon…
lglycylasparaginylserylglutamylprolyls…
phenylalanylisoleucylserylcysteinylarg…
nylprolylglycylprolylprolylserylalanyl…
onylthreonyllysylhistidylserylisoleucy…
llysylprolylmethionyltyrosylaspartylgl…
valylglycyltyrosylvalylleucylglutamylm…
rtylthreonylaspartylglutaminyltryptoph…
ylasparaginylalanylthreonylisoleucylar…
nylalanylthreonylvalylprolylaspartylle…
ysyltyrosylserylphenylalanylarginylval…
lysylglycylmethionylserylglutamyltyros…
glutamylisoleucylglutamylprolylvalylgl…
ucylprolylaspartylleucylglutamylleucyl…
sylthreonylvalylthreonylisoleucylargin…
nylleucylmethionylvalylserylvalylseryl…
lisoleucylthreonyltryptophylseryllysyl…
ucylalanylserylarginylalanylisoleucyli…
tamylseryltyrosylserylleucylleucylisol…
inylarginyltyrosylaspartylalanylglycyl…
ylalanylglutamylasparaginylglutaminyls…
onylvalylleucylvalyllysylvalyltyrosyla…
steinylprolylserylvalyllysylvalyllysyl…
rylvalylthreonylisoleucylthreonyltrypt…
lisoleucylaspartylglycylglycylalanylpr…
tyrosylisoleucylvalylglutamyllysylargi…
inylalanylphenylalanyllysylthreonylval…
yllysylthreonylleucyltyrosylarginyliso…
lglycylthreonylmethionylhistidyltyrosy…
ylglutamylasparaginylisoleucyltyrosylg…
ysteinylglutamylthreonylserylaspartyla…
alylprolylleucylvalylprolylalanyllysyl…
ylthreonyllysylserylthreonylvalylthreo…
sylprolylleucyltyrosylaspartylglycylgl…
ltyrosylvalylleucylglutamylalanylcyste…
ylarginyltryptophylmethionyllysylvalyl…
nylvalylleucylglutamylhistidylthreonyl…
glutamylglycylglutamylglutaminyltyrosy…
arginylalanylglutaminylasparaginylglut…
olylarginylglutamylthreonylvalylthreon…
laspartylleucylarginylvalylleucylproly…
ylthreonylmethionylprolylglutaminyllys…
lylalanylglycylarginylprolylvalylgluta…
cylalanylglycylarginylprolylprolylprol…
alanylphenylalanylalanylglycylseryllys…
larginylvalylthreonylvalylglutamylthre…
llysylleucylthreonylisoleucylarginylgl…
nylaspartylthreonylglycylglutamyltyros…
asparaginylvalylthreonylglycylthreonyl…
cyllysylvalylisoleucylisoleucylleucyla…
lthreonylglycylprolylisoleucyllysyliso…
rtylalanylthreonylserylisoleucylthreon…
rolylprolylglutamylleucylaspartylglycy…
ltyrosylvalylvalylglutamylglutaminylar…
rolylglycyltryptophylleucylprolylvalyl…
nylserylthreonylphenylalanyllysylpheny…
lglutamylglycylasparaginylglutamyltyro…
nylalanylthreonylasparaginylarginylphe…
tyrosylleucylglutaminylserylglutamylva…
lserylserylisoleucylarginylisoleucylpr…
nylleucylglutaminylisoleucylphenylalan…
glycylmethionylthreonylleucylthreonylt…
laspartylaspartylglycylglycylserylglut…
leucylvalylglutamylarginyllysylglutamy…
ryptophylvalylarginylvalylasparaginyll…
ylthreonylarginyltyrosylarginylserylth…
lycylleucylglutamyltyrosylglutamylhist…
ucylasparaginylalanylarginylglycylsery…
lseryllysylprolylisoleucylvalylalanylm…
ylprolylprolylglycyllysylprolylglutami…
eonylaspartylthreonylthreonylarginylth…
yptophylserylvalylprolylglutamylaspart…
ylthreonylglycyltyrosylleucylisoleucyl…
ylaspartylglutaminylhistidylglutamyltr…
aginylthreonylthreonylprolylthreonylly…
hreonylleucylthreonylhistidylleucylpro…
rosylarginylphenylalanylarginylvalylle…
lglycylglycylprolylglycylglutamylproly…
eonylvalyllysylvalylthreonylglutamylme…
spartyltyrosylglutamylleucylaspartylgl…
mylglycylisoleucylphenylalanylvalylarg…
eucylarginylleucylthreonylisoleucylpro…
henylalanylprolylisoleucylcysteinyllys…
ycylglutaminylaspartylisoleucylserylly…
lanylthreonylserylglutamylthreonylhist…
eucyllysylglutamylalanylaspartylarginy…
yrosylaspartylleucylvalylleucylglutamy…
yllysylalanylvalyltyrosylisoleucyllysy…
rylprolylasparaginylserylprolylglutamy…
spartylaspartylisoleucylglutaminylvaly…
tryptophylarginylprolylprolylalanylasp…
rtylisoleucylleucylglycyltyrosylisoleu…
amylvalylprolyllysylalanylalanyltrypto…
lserylarginylvalylarginylglycylthreony…
ucyllysylglutamylasparaginylvalylgluta…
ylvalylserylalanylglutamylasparaginylg…
lseryllysylprolylleucyllysylserylgluta…
llysylthreonylprolylleucylasparaginylp…
lasparaginylprolylprolylglutamylvalyll…
lserylvalylserylleucylseryltryptophyls…
tylglycylglycylserylarginylvalylthreon…
amylarginyllysylglutamylthreonylserylt…
ylhistidylasparaginyllysylthreonylglut…
onylmethionyltyrosylthreonylvalylthreo…
lanylglutamyltyrosylglutaminylphenylal…
glutaminylasparaginylaspartylvalylglyc…
rolylalanylserylglutamylprolylvalylval…
lalanylaspartyllysylprolylserylglutami…
ylisoleucylleucylserylisoleucylserylly…
glutaminyltryptophylglutamyllysylproly…
cyllysylglutamylisoleucylleucylglycylt…
larginylglutaminylserylglycylaspartyls…
asparaginyllysylglutamylarginylisoleuc…
lalanylthreonylisoleucylglycylglycylle…
tamyltyrosylglutamylphenylalanylarginy…
araginylglutamylthreonylglycylleucylse…
nylalanylmethionylserylisoleucyllysylt…
ylglutamylalanylprolylglycylisoleucyla…
partylvalylthreonylthreonyllysylleucyl…
lleucylserylcysteinylglutaminylisoleuc…
lylaspartylisoleucyllysyltryptophyltyr…
lutamylleucylisoleucylglutaminylseryla…
ylserylaspartylglycylarginylthreonylhi…
thionylthreonylglutamylglutamylglutami…
lyltyrosylthreonylcysteinylisoleucylal…
lglycylglutamylvalylglutamylthreonylse…
aminylalanylthreonylprolylglutaminylph…
ylprolylleucyllysylglutamyllysyltyrosy…
lthreonylleucylarginylleucylhistidylva…
rginylprolylvalylprolylalanylmethionyl…
dylglycylglutaminyllysylleucylleucylgl…
araginylisoleucylthreonylisoleucylglut…
idyltyrosylthreonylhistidylleucylvalyl…
minylarginyllysylthreonylhistidylalany…
inylleucylserylasparaginylvalylphenyla…
nylisoleucylleucylaspartylvalylglutamy…
olylaspartyllysylprolylthreonylglycylp…
lalanylleucylleucyllysylasparaginylser…
yllysylprolylprolylalanylaspartylaspar…
ucylthreonylasparaginyltyrosylvalylval…
nyllysylglutamylglycylalanylglutamyltr…
erylalanylisoleucylserylvalylthreonylt…
ylasparaginylleucylthreonylglutamylasp…
henylalanylarginylvalylserylalanylglut…
ylglycylisoleucylserylaspartylprolylle…
ylisoleucylisoleucyllysylserylprolylph…
alanylprolylglycyllysylprolylthreonyli…
lysylaspartylserylcysteinylvalylvalyla…
nylserylaspartylglycylglycylalanyllysy…
tyrosylleucylglutamyllysylarginylgluta…
ysyltryptophylisoleucylserylvalylthreo…
larginylglutamylthreonylvalylphenylala…
isoleucylglutamylglycylleucylglutamylt…
lyllysylcysteinylglutamylasparaginylle…
yltryptophylserylglutamylisoleucylsery…
lyllysylserylaspartylvalylprolylisoleu…
enylalanyllysylglutamylglutamylleucyla…
alylarginyltyrosylglutaminylserylaspar…
einyllysylvalylthreonylglycylhistidylp…
tryptophyltyrosylarginylglutaminylglyc…
anylaspartylglycylleucyllysyltyrosylar…
nylalanyllysylglycylglycyltyrosylhisti…
ylalanylserylvalylthreonylaspartylaspa…
sylglutaminylvalylarginylalanylthreony…
erylvalylserylglycylthreonylalanylsery…
olylalanyllysylisoleucylhistidylleucyl…
ycylmethionylglycylalanylvalylhistidyl…
lylvalylserylisoleucyllysylisoleucylpr…
lylaspartylprolylvalylisoleucylthreony…
taminylaspartylleucylisoleucylaspartyl…
ltyrosylglutaminylvalylisoleucylvalylt…
onylserylleucylvalylphenylalanylprolyl…
yllysylaspartylalanylglycylphenylalany…
sylasparaginylarginylphenylalanylglycy…
reonylvalylglutamylleucylaspartylvalyl…
olylprolylarginylglycylvalyllysylvalyl…
rtylserylvalylasparaginylleucylthreony…
anylserylaspartylglycylglycylseryllysy…
lisoleucylvalylglutamyllysylcysteinyla…
arginyltryptophylleucylarginylvalylgly…
hreonylarginyltyrosylthreonylvalylisol…
lycyllysylthreonylseryltyrosylglutamin…
alanylglutamylasparaginyllysylphenylal…
ylglutamylprolylserylglutamylprolylthr…
aspartyllysylthreonylarginylalanylmeth…
amylglutamylvalylaspartylglutamylthreo…
ylthreonyllysylalanylserylhistidylsery…
rosylglutamyllysyltyrosylmethionylisol…
ycylarginylglycylglutamylphenylalanylg…
ysteinylvalylglutamylthreonylserylsery…
alanyllysylphenylalanylvalyllysylvalyl…
ylvalylleucylvalyllysyllysylglutamylis…
nylisoleucylalanylarginylhistidylargin…
lleucylhistidylglutamylserylphenylalan…
tamylleucylvalylmethionylisoleucylphen…
ylserylglycylleucylaspartylisoleucylph…
sparaginylthreonylserylalanylphenylala…
larginylglutamylisoleucylvalylseryltyr…
teinylglutamylalanylleucylglutaminylph…
ylasparaginylisoleucylglycylhistidylph…
rolylglutamylasparaginylisoleucylisole…
larginylserylserylthreonylisoleucyllys…
lanylglycylglutaminylalanylarginylglut…
ylasparaginylphenylalanylarginylleucyl…
lylglutamyltyrosyltyrosylalanylprolylg…
dylaspartylvalylvalylserylthreonylalan…
ylserylleucylglycylthreonylleucylvalyl…
isoleucylasparaginylprolylphenylalanyl…
inylglutaminylglutaminylisoleucylisole…
hionylasparaginylalanylglutamyltyrosyl…
lglutamylalanylphenylalanyllysylglutam…
anylmethionylaspartylphenylalanylvalyl…
ylglutamylarginyllysylserylarginylmeth…
nylleucylglutaminylhistidylprolyltrypt…
eucylglutamylarginylvalylserylthreonyl…
eucyllysylhistidylarginylarginyltyrosy…
ucyllysyllysylaspartylleucylasparaginy…
ylarginylisoleucylserylcysteinylglycyl…
utaminyllysylglycylvalylserylvalylalan…
oleucylglutamylisoleucylglycylprolylva…
thionylhistidylalanylvalylglycylglutam…
lysyltyrosylvalylcysteinyllysylisoleuc…
lglutaminylserylthreonylglutaminylvaly…
nylglycylvalylarginylglutaminylleucylg…
ltyrosylglutamylisoleucylthreonyltyros…
isoleucylleucyltyrosylvalyllysylaspart…
tylaspartylglycylthreonyltyrosylarginy…
laspartyltyrosylglycylglutamylaspartyl…
ylphenylalanylvalyllysylglycylvalylarg…
osyltyrosylcysteinylarginylarginylthre…
ylarginylarginylthreonylaspartylthreon…
mylarginylprolylprolylglutamylphenylal…
ylasparaginyllysylthreonylalanyltyrosy…
larginylphenylalanylglycylvalylthreony…
ylglutamylprolylhistidylvalylthreonylt…
taminyllysylisoleucyllysylprolylglycyl…
yltyrosylthreonylphenylalanylglutamyls…
lglutaminylleucylthreonylisoleucylaspa…
partylaspartylaspartylalanylglutamylty…
lasparaginyllysyltyrosylglycylglutamyl…
sylleucylthreonylvalylthreonylleucylhi…
artylserylthreonylleucylarginylprolylm…
cylleucylalanylasparaginylalanylglutam…
glutaminylserylvalylcysteinylphenylala…
ylglycylisoleucylprolylprolylprolylthr…
ysylaspartylglycylglutaminylprolylleuc…
lisoleucylglutamylisoleucylisoleucylhi…
yrosyltyrosylalanylleucylhistidylisole…
olylglutamylaspartylthreonylglycyltyro…
lthreonylasparaginylthreonylalanylglyc…
inylalanylhistidylleucylglutaminylvaly…
llysyllysylglutaminylglutamylphenylala…
istidylglutamylarginylhistidylvalylglu…
rtyllysylthreonylleucylarginylmethiony…
glycylthreonylglutamylserylvalylprolyl…
lysylglutamylalanylleucylarginylglutam…
ylprolylalanylvalylserylthreonyllysylt…
ylalanylarginylleucylglutamylisoleucyl…
lutamylarginyllysylleucylarginylmethio…
glutamylprolylarginyllysyltyrosyllysyl…
glutamylglutamylaspartylglutaminylargi…
anylvalylprolylmethionylserylaspartylm…
lysylisoleucylarginylaspartylglutaminy…
yllysylleucylaspartylarginylvalylvalyl…
ginylisoleucylarginylleucylserylarginy…
alanyltyrosylvalylmethionylprolylleucy…
rtylglutaminyltyrosylarginylprolyllysy…
sylleucylserylglutaminylaspartylaspart…
ylprolylalanylarginylarginylarginylthr…
ylaspartylphenylalanyltyrosyltyrosylar…
ylleucylglycylaspartylisoleucylserylas…
eucylprolylisoleucylaspartylaspartylty…
nylthreonylglutamylglutamylglutamylarg…
amylglutamylleucylglutamylleucylglycyl…
rolylserylarginylserylprolylprolylhist…
serylleucylarginyltyrosylserylserylpro…
ylvalylglutamylglutamylthreonylarginyl…
tyrosylserylthreonyltyrosylhistidyliso…
amylalanylserylthreonylseryltyrosylala…
inylhistidylalanylglutaminylalanylalan…
ylglutaminylarginylglutaminylarginylis…
ylglutamylaspartylglutamylglutamylleuc…
hreonylthreonylglutaminylhistidylleucy…
amylleucylaspartylphenylalanylmethiony…
ylarginyllysyllysylserylarginylarginyl…
nylglutamylisoleucylthreonylglutamylis…
sylglutamylisoleucylseryllysylhistidyl…
lserylserylserylalanylserylarginylleuc…
lserylleucylserylprolylthreonyltyrosyl…
inylprolylvalylserylglutamylleucylisol…
minylprolylalanylglutamylglutamyltyros…
lutamylarginylarginylserylprolylthreon…
nylprolylarginylserylprolylserylprolyl…
leucylserylarginylphenylalanylglutamyl…
ylaspartylisoleucylphenylalanylserylar…
ysylalanylalanylleucyllysylthreonylglu…
ginyllysyltyrosylglutamylvalylleucylse…
alanylthreonylleucylaspartylhistidylal…
eucylarginylmethionylarginylserylhisti…
lglutaminylasparaginylthreonylarginylp…
ylvalylglutaminylseryllysylprolylthreo…
yltyrosylhistidylasparaginylglycylvaly…
rylseryllysylisoleucylhistidyltyrosylt…
ylvalylleucylthreonylleucylglutamyliso…
ylthreonylaspartylaspartylserylglycylt…
teinylthreonylasparaginyltyrosyllysylg…
osylalanylthreonylleucylaspartylvalylt…
hreonylthreonyltyrosylalanylserylgluta…
glutamylvalylprolylarginylserylvalylph…
nylarginylthreonylglutamylalanyltyrosy…
lysyllysylthreonylserylglutamylmethion…
larginylglutamylvalyllysylserylglutami…
larginylglutamylserylleucylserylserylt…
rylalanylglutamylmethionyllysylserylal…
ylserylleucylglutamylglutamyllysylsery…
cyllysylthreonylthreonylleucylalanylal…
ysylprolylarginylserylmethionylthreony…
serylalanylarginylphenylalanylserylcys…
lglutamylprolylvalylprolylthreonylvaly…
ylglycylglutaminylvalylleucylserylthre…
minylvalylthreonylthreonylthreonyllysy…
nylglutamylisoleucylserylserylvalylglu…
lycylasparaginyltyrosylserylvalylvalyl…
ylglycyllysylglutaminylglutamylalanylg…
reonylisoleucylglutaminyllysylalanylar…
ylvalylthreonylserylprolylprolylarginy…
larginylvalyllysylserylprolylglutamyla…
nylvalyllysylserylprolylglutamylprolyl…
serylprolylthreonylglutamylthreonyllys…
yllysylvalylglutaminylhistidylleucylpr…
ylisoleucylthreonylglutaminylphenylala…
eryllysylglutamylisoleucylalanyllysyll…
tamylserylserylvalylleucylarginylalany…
yltyrosyllysylaspartylglycyllysyllysyl…
lhistidylphenylalanylglutaminylphenyla…
rtylglycylthreonyltyrosylglutamylleucy…
ylleucylthreonylglutamylserylaspartylg…
cysteinylglutamylisoleucylserylglycylg…
ylthreonylasparaginylleucylglutaminylp…
lalanylphenylalanyllysylserylisoleucyl…
lisoleucylserylglutamylthreonyllysylly…
onylthreonylglutamylserylthreonylvalyl…
lprolyllysylalanylprolylglutamylprolyl…
isoleucylvalylthreonylglycylleucylglut…
serylserylaspartylserylvalylalanyllysy…
threonylglycylglutamylprolylarginylpro…
lthreonyllysylaspartylglycyllysylalany…
lycyllysyltyrosyllysylleucylserylgluta…
lanylphenylalanylleucylglutamylisoleuc…
onylserylaspartylserylglycylleucyltyro…
sylasparaginylserylalanylglycylserylva…
cylthreonylisoleucyllysylalanylisoleuc…
ylglutaminyllysylvalylserylthreonylglu…
oleucylthreonylprolylglutaminyllysylly…
ylglutamylisoleucylserylglutaminyllysy…
utamylisoleucyllysylmethionylserylglut…
myllysylleucylalanylleucyllysylglutamy…
lisoleucylserylglutamylglutamylvalylly…
rylleucylglutamyllysylserylisoleucylva…
lthreonyllysylthreonylserylglutaminyla…
nylthreonylhistidylalanylglutamylisole…
eonylglutaminylmethionylserylisoleucyl…
arginylleucylvalylleucyllysylalanylasp…
threonylaspartylvalyllysyltryptophylva…
amylleucylthreonylasparaginylserylglut…
ycylvalylserylglycylserylaspartylgluta…
llysylglutaminylalanylserylhistidylarg…
leucylthreonylcysteinylisoleucylseryll…
eucylvalyllysylcysteinylglutaminyltyro…
llysylglutamylleucylserylaspartylalany…
erylglutaminylprolylarginylserylglutam…
glutamylglycylglutaminylasparaginylval…
ylglutamylisoleucylserylglycylglutamyl…
lutamyltryptophylphenylalanyllysylaspa…
ucylserylisoleucylserylserylasparaginy…
ylarginylasparaginylvalyltyrosylseryll…
ginylalanylserylvalylserylaspartylsery…
llysylalanyllysylasparaginylphenylalan…
erylalanylthreonylalanylserylleucylmet…
lutamylglutamylprolylserylarginylgluta…
erylglycylaspartylthreonylserylleucylg…
ylserylglutaminylserylvalylglutaminylm…
inylglutamylalanylserylphenylalanylser…
erylalanylserylserylmethionylthreonylg…
anylserylmethionylserylalanylglutaminy…
lutaminylglutamylserylphenylalanylvaly…
rylphenylalanylmethionylglycylisoleucy…
lutaminylleucylglutamylserylserylthreo…
anylglycylisoleucylarginylglycylisoleu…
ylalanylleucylprolylserylaspartylisole…
lycyllysylvalylleucylthreonylvalylalan…
ylglycylglutamylprolylthreonylprolylgl…
ysteinylglycylglycylarginyllysylisoleu…
lutaminylglycylarginylphenylalanylhist…
eonylaspartylaspartylleucylthreonylthr…
nylaspartylvalylglutaminyllysylglutami…
lthreonylleucylserylleucylglycylaspara…
laspartylserylalanylthreonylvalylaspar…
inylserylisoleucine






tên full http://answers.yahoo.com/question/index?qid=20061113221628AAxlNn5

tên full http://answers.yahoo.com/question/index?qid=20061113221628AAxlNn5

tên full http://answers.yahoo.com/question/index?qid=20061113221628AAxlNn5

Đọc cái này đọc xong mà không biết mình vừa nói lảm nhảm cái gì

rảnh vice cả lone 3crisp3

#4468758 0
Methionylthreonylthreonylglutaminylala…
ylglutaminylprolylleucylglutaminylsery…
lserylthreonylalanylthreonylphenylalan…
rylglycylphenylalanylprolylvalylprolyl…
lanylarginylaspartylglycylglutaminylva…
nylleucylprolylglycylvalylglutaminylis…
ylglycylarginylalanyllysylleucylthreon…
llysylalanylasparaginylserylglycylargi…
eonylasparaginylglycylserylglycylgluta…
nylglutamylleucylleucylvalyllysylalany…
asparaginylphenylalanylvalylglutaminyl…
ylthreonylvalylarginylglutaminylglycyl…
utaminylvalylarginylvalylthreonylglycy…
lylvalyllysylphenylalanyltyrosylarginy…
cylglutaminylserylserylleucylaspartylp…
glutaminylglutamylglycylaspartylleucyl…
anylglutamylalanyltyrosylprolylglutamy…
serylvalylasparaginylalanylthreonylasp…
ylthreonylserylthreonylalanylglutamyll…
tamylglutamylglutamylvalylprolylalanyl…
eucylvalylserylthreonylalanylglutaminy…
glutaminylthreonylarginylisoleucylglut…
ylhistidylphenylalanylaspartylalanylar…
lylglutamylmethionylvalylisoleucylaspa…
nylglutaminylleucylprolylhistidyllysyl…
lprolylprolyllysylprolyllysylserylargi…
erylisoleucylalanylalanyllysylalanylgl…
ylglutaminylserylprolylserylprolylisol…
lprolylvalylarginylhistidylvalylarginy…
lylvalylarginylserylvalylserylprolylal…
onylserylprolylisoleucylarginylserylva…
thionylarginyllysylthreonylglutaminyla…
ylglycylprolylglutamylvalylprolylproly…
tamylglycyltyrosylvalylalanylserylsery…
ylarginylglutamylthreonylthreonylleucy…
minylisoleucylarginylthreonylglutamylg…
cylarginyltyrosylglycylvalylglutaminyl…
eucylserylglycylalanylalanylglycylalan…
serylalanylseryltyrosylalanylalanylglu…
lalanyllysylglutamylvalyllysylglutamin…
lanylalanylvalylalanylthreonylvalylval…
lalanylarginylvalylarginylglutamylprol…
tamylglutaminylthreonylalanylglutaminy…
eonylalanylvalylhistidylisoleucylgluta…
glutaminylvalylarginyllysylglutamylala…
threonyllysylvalylvalylvalylalanylalan…
lutaminylglutamylleucyllysylserylargin…
leucylthreonylthreonyllysylglutaminylg…
alylthreonylhistidylglutamylglutaminyl…
ylglutamyllysylthreonylphenylalanylval…
ylalanylalanyllysylalanyllysylglutamyl…
oleucylserylglutamylglutamylisoleucylt…
taminylvalylthreonylglutaminylglutamyl…
ylthreonylarginyllysylthreonylvalylval…
nylthreonylprolyllysylvalyllysylglutam…
larginylglycylarginylglutamylglycyliso…
lutamylglutaminylvalylglutaminylisoleu…
ethionylarginyllysylglutamylalanylglut…
hreonylisoleucylalanylvalylalanylthreo…
utaminylglutamylthreonylisoleucylleucy…
onylmethionylalanylthreonylarginylglut…
utaminylvalylthreonylhistidylglycyllys…
lalanylglutamylalanylvalylalanylthreon…
ylglutaminylalanylarginylvalylarginylg…
lycylhistidylleucylglutamylglutamylser…
threonylthreonylleucylglutamyltyrosylg…
leucylserylalanylalanyllysylvalylalany…
nylprolylalanylserylglutamylprolylhist…
llysylprolylarginylvalylisoleucylgluta…
nylhistidylisoleucyllysylthreonylthreo…
hionylhistidylisoleucylserylserylgluta…
eonylaspartylleucylthreonylthreonylglu…
laspartyllysylarginylprolylarginylthre…
alanylthreonylvalylseryllysylisoleucyl…
ylhistidylglycyltyrosylglutamylalanyls…
lisoleucylalanylthreonylleucylglutamin…
eonylserylserylalanylglutaminyllysylis…
alanylprolylthreonylvalyllysylprolylse…
nylalanylglutamylprolylthreonylprolyll…
olylphenylalanylalanylaspartylthreonyl…
erylglutamylalanylglycylvalylglutamylv…
lylserylisoleucylthreonylglycylthreony…
ylarginylphenylalanylglutamylvalylleuc…
yllysylvalylthreonylglutamylthreonylal…
alylglutamylisoleucylprolylvalylthreon…
rylglycylleucyllysylasparaginylvalylth…
lutamylserylvalylthreonylleucylglutamy…
cyltyrosylprolylserylprolylthreonylval…
lutamylaspartyltyrosylglutaminylisoleu…
tylphenylalanylglutaminylisoleucylthre…
ylisoleucylalanylarginylleucylmethiony…
ylalanylalanylglutamylaspartylserylgly…
inylserylalanylvalylasparaginylglutamy…
onylserylcysteinyltyrosylleucylalanylv…
tamylphenylalanylglutamyllysylglutamyl…
glutamyllysylphenylalanylthreonylthreo…
ylalanylvalylglutamylserylarginylaspar…
tylthreonylserylleucylthreonylglutamyl…
lglycylglutamylprolylalanylalanylproly…
yllysylprolylvalylvalylglutaminyllysyl…
lvalylvalylphenylalanylglycylcysteinyl…
nylprolyllysylprolylhistidylvalyltyros…
lylprolylleucylthreonylthreonylglycylt…
tyrosylasparaginyllysylglutaminylthreo…
ylvalylisoleucylserylmethionylthreonyl…
lanylglycylglutamyltyrosylthreonylisol…
sylhistidylglycylglutamylthreonylseryl…
lutamylglutamylalanylaspartyltyrosylgl…
ylglutaminylglutaminylglutamylmethiony…
taminylvalylthreonylalanylphenylalanyl…
ylvalylglycylglutamylthreonylalanylpro…
rylglutamyltyrosylglutamyllysylglutamy…
inylalanylleucylisoleucylarginyllysyll…
eonylvalylvalylvalylarginylthreonyltyr…
glutamylphenylalanylhistidylisoleucyls…
ylarginylleucylisoleucyllysylglutamyli…
ucylisoleucyllysylthreonylthreonylleuc…
mylglutamylaspartylglycylglutamylgluta…
lisoleucylserylglutamylserylglutamylal…
lanylaspartylleucylarginylisoleucyllys…
lleucylglutamylglycylmethionylglycylva…
einyllysylmethionylserylglycyltyrosylp…
yltryptophyltyrosyllysylaspartylglycyl…
lycylglutamylarginyltyrosylglutaminylm…
lutaminylaspartylglycylarginylalanylse…
lvalylleucylprolylglutamylaspartylglut…
lanylphenylalanylalanylserylasparaginy…
nylisoleucylcysteinylserylglycyllysyll…
ylalanylprolylleucylglycylalanylprolyl…
nylleucylglutamylprolylvalylserylargin…
rolylarginylserylvalylserylarginylsery…
ylprolylalanylarginylmethionylserylpro…
lalanylarginylmethionylserylprolylalan…
arginylarginylleucylglutamylglutamylth…
ylleucylglutamylarginylleucyltyrosylly…
yllysylprolylvalylserylphenylalanyllys…
ylasparaginylcysteinylarginylphenylala…
cylarginylprolylmethionylprolylglutamy…
ylalanylhistidylaspartylglycylglutamin…
ylaspartyltyrosylthreonylhistidyllysyl…
artylglycylthreonylglutaminylserylleuc…
ylthreonylprolylserylaspartylserylglyc…
lylalanylglutaminylasparaginylarginyla…
ylserylvalylisoleucylleucylthreonylval…
ylglutaminylvalyllysylprolylmethionylp…
lysylasparaginylvalylasparaginylisoleu…
eucylglutamylmethionyllysylvalylarginy…
lylasparaginylprolylaspartylisoleucylv…
lserylaspartylisoleucylisoleucylvalylp…
lisoleucylarginylisoleucylglutamylglyc…
alanylleucyllysylisoleucylaspartylsery…
ylserylalanyltryptophyltyrosylthreonyl…
ginyllysylalanylglycylarginylaspartylt…
lvalylasparaginylvalylglutamylvalylglu…
ylglutamylprolylglutamylarginyllysylle…
glycylthreonyltyrosylarginylalanyllysy…
lglutamylleucylglutamylprolylleucylhis…
aminylglutamylglutaminyltryptophylglut…
osylaspartyllysylglutamyllysylglutamin…
phenylalanyllysyllysyllysylleucylthreo…
inylphenyla